Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z8F0

Protein Details
Accession A0A316Z8F0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-35ILAAASKTSKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
11-28AASKTSKKKKWSKGKVKD
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKAAILAAASKTSKKKKWSKGKVKDKAQNMVVLDRPTYDKILKEVPTFKMISQSTLIDRMKINGSLARVAIQHLEREGQIKKVIHHHGQLVYTRVSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.44
4 0.5
5 0.58
6 0.65
7 0.75
8 0.82
9 0.85
10 0.88
11 0.93
12 0.93
13 0.93
14 0.9
15 0.84
16 0.8
17 0.71
18 0.64
19 0.54
20 0.46
21 0.39
22 0.32
23 0.26
24 0.2
25 0.2
26 0.17
27 0.18
28 0.17
29 0.14
30 0.15
31 0.2
32 0.21
33 0.21
34 0.24
35 0.23
36 0.25
37 0.25
38 0.23
39 0.25
40 0.23
41 0.22
42 0.2
43 0.19
44 0.17
45 0.23
46 0.23
47 0.17
48 0.17
49 0.18
50 0.18
51 0.17
52 0.18
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.12
59 0.12
60 0.15
61 0.14
62 0.13
63 0.13
64 0.14
65 0.13
66 0.17
67 0.18
68 0.18
69 0.23
70 0.23
71 0.26
72 0.33
73 0.4
74 0.41
75 0.43
76 0.45
77 0.43
78 0.45
79 0.45
80 0.4
81 0.34