Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CEA3

Protein Details
Accession A1CEA3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-78TGEHPTKREFRARRSHRKSRAGCLVCHydrophilic
NLS Segment(s)
PositionSequence
60-71REFRARRSHRKS
Subcellular Location(s) plas 8, cyto 7, nucl 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG act:ACLA_088930  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
CDD cd00067  GAL4  
Amino Acid Sequences MSSTDTPSPAEAASRSQSMAISNPPGPSGPLQGQKSLFRIPMYKPTGTRSSSTGEHPTKREFRARRSHRKSRAGCLVCKTRRVKACCFVPAVTKTGPHPCDEAKPHCLRCQKHGVECVYTAPGDSTGGEGGAALLAQTKPGFASPDSRAYSMHLLEVSEKIDELLGLGSKKRQLPGTVGALHHFHNVTTPTVGAPRTQELLRQEVAELAFSVSAKRVSIVAKQLTRQTQTPFVMHTLIAVATSHLSHAVPDNTAYKLAEAYHWQRAIGQYSKELASGVGPHNMDSLFSTCLLMTVNSFALDEYNPRKSFVFSDDPGALSWLILQGGLRHLLGLTRPWLCISMWLGVFMDNVEESKVFDDHRPGRAGLHPALADICGIEDTTTEESNPYLWPLRMLTALLAAERSMKSFSMYTTFMGRLLPIFWDRLANKDPPALVILGWWLALLDSIGLWWAQTRVRSECAAICMYLEDSEDARVLRLLEFPAGVAGYLLKHVQDQTWEEDSAVIDTLLLCQPDTDFAALAEMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.21
5 0.21
6 0.22
7 0.22
8 0.24
9 0.25
10 0.25
11 0.25
12 0.25
13 0.25
14 0.24
15 0.25
16 0.27
17 0.32
18 0.34
19 0.38
20 0.41
21 0.43
22 0.45
23 0.44
24 0.4
25 0.34
26 0.37
27 0.36
28 0.42
29 0.45
30 0.45
31 0.43
32 0.46
33 0.51
34 0.49
35 0.47
36 0.4
37 0.38
38 0.36
39 0.39
40 0.43
41 0.43
42 0.47
43 0.49
44 0.54
45 0.57
46 0.6
47 0.65
48 0.62
49 0.64
50 0.7
51 0.76
52 0.79
53 0.82
54 0.87
55 0.87
56 0.91
57 0.87
58 0.85
59 0.85
60 0.8
61 0.75
62 0.73
63 0.73
64 0.67
65 0.71
66 0.65
67 0.63
68 0.66
69 0.66
70 0.66
71 0.64
72 0.66
73 0.63
74 0.62
75 0.55
76 0.53
77 0.49
78 0.46
79 0.38
80 0.33
81 0.31
82 0.37
83 0.36
84 0.31
85 0.32
86 0.3
87 0.37
88 0.42
89 0.44
90 0.44
91 0.51
92 0.52
93 0.56
94 0.61
95 0.56
96 0.56
97 0.61
98 0.58
99 0.57
100 0.61
101 0.57
102 0.52
103 0.5
104 0.44
105 0.35
106 0.29
107 0.23
108 0.16
109 0.13
110 0.1
111 0.1
112 0.08
113 0.07
114 0.07
115 0.06
116 0.06
117 0.05
118 0.04
119 0.04
120 0.03
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.1
129 0.09
130 0.15
131 0.17
132 0.25
133 0.27
134 0.28
135 0.27
136 0.28
137 0.31
138 0.25
139 0.23
140 0.16
141 0.14
142 0.15
143 0.15
144 0.13
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.06
151 0.05
152 0.06
153 0.07
154 0.08
155 0.1
156 0.14
157 0.17
158 0.19
159 0.2
160 0.2
161 0.24
162 0.28
163 0.32
164 0.31
165 0.3
166 0.29
167 0.28
168 0.27
169 0.25
170 0.2
171 0.14
172 0.13
173 0.14
174 0.13
175 0.12
176 0.12
177 0.1
178 0.12
179 0.13
180 0.11
181 0.12
182 0.12
183 0.14
184 0.14
185 0.17
186 0.17
187 0.2
188 0.2
189 0.18
190 0.17
191 0.16
192 0.16
193 0.13
194 0.11
195 0.07
196 0.07
197 0.07
198 0.07
199 0.06
200 0.07
201 0.06
202 0.06
203 0.08
204 0.09
205 0.12
206 0.18
207 0.22
208 0.23
209 0.25
210 0.3
211 0.31
212 0.32
213 0.32
214 0.28
215 0.3
216 0.3
217 0.28
218 0.25
219 0.23
220 0.21
221 0.18
222 0.16
223 0.1
224 0.08
225 0.07
226 0.06
227 0.05
228 0.04
229 0.05
230 0.04
231 0.05
232 0.05
233 0.05
234 0.07
235 0.07
236 0.07
237 0.08
238 0.1
239 0.1
240 0.1
241 0.1
242 0.08
243 0.08
244 0.08
245 0.08
246 0.1
247 0.13
248 0.17
249 0.17
250 0.17
251 0.17
252 0.18
253 0.22
254 0.21
255 0.18
256 0.15
257 0.16
258 0.17
259 0.16
260 0.14
261 0.1
262 0.08
263 0.1
264 0.1
265 0.12
266 0.12
267 0.12
268 0.12
269 0.12
270 0.12
271 0.1
272 0.1
273 0.08
274 0.08
275 0.08
276 0.07
277 0.08
278 0.08
279 0.07
280 0.05
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.1
289 0.12
290 0.19
291 0.19
292 0.2
293 0.21
294 0.21
295 0.23
296 0.25
297 0.27
298 0.21
299 0.24
300 0.24
301 0.24
302 0.22
303 0.22
304 0.16
305 0.1
306 0.09
307 0.06
308 0.05
309 0.05
310 0.05
311 0.05
312 0.06
313 0.07
314 0.07
315 0.06
316 0.06
317 0.07
318 0.07
319 0.08
320 0.1
321 0.11
322 0.11
323 0.11
324 0.13
325 0.12
326 0.14
327 0.15
328 0.15
329 0.14
330 0.15
331 0.14
332 0.13
333 0.13
334 0.1
335 0.09
336 0.05
337 0.05
338 0.05
339 0.05
340 0.05
341 0.07
342 0.08
343 0.09
344 0.1
345 0.18
346 0.22
347 0.26
348 0.28
349 0.27
350 0.29
351 0.31
352 0.35
353 0.28
354 0.27
355 0.22
356 0.2
357 0.2
358 0.18
359 0.13
360 0.09
361 0.07
362 0.05
363 0.05
364 0.04
365 0.04
366 0.07
367 0.09
368 0.1
369 0.09
370 0.1
371 0.1
372 0.11
373 0.11
374 0.11
375 0.11
376 0.11
377 0.13
378 0.13
379 0.15
380 0.14
381 0.14
382 0.12
383 0.11
384 0.12
385 0.1
386 0.1
387 0.08
388 0.11
389 0.11
390 0.12
391 0.11
392 0.11
393 0.12
394 0.13
395 0.14
396 0.15
397 0.16
398 0.16
399 0.18
400 0.19
401 0.17
402 0.17
403 0.16
404 0.12
405 0.12
406 0.14
407 0.12
408 0.13
409 0.13
410 0.19
411 0.19
412 0.24
413 0.27
414 0.27
415 0.27
416 0.29
417 0.29
418 0.23
419 0.25
420 0.2
421 0.15
422 0.13
423 0.12
424 0.09
425 0.09
426 0.08
427 0.06
428 0.05
429 0.05
430 0.05
431 0.03
432 0.03
433 0.03
434 0.04
435 0.04
436 0.04
437 0.05
438 0.07
439 0.09
440 0.13
441 0.18
442 0.21
443 0.24
444 0.26
445 0.27
446 0.28
447 0.3
448 0.28
449 0.23
450 0.2
451 0.18
452 0.17
453 0.15
454 0.14
455 0.11
456 0.1
457 0.11
458 0.12
459 0.11
460 0.11
461 0.12
462 0.12
463 0.12
464 0.13
465 0.14
466 0.14
467 0.13
468 0.13
469 0.13
470 0.12
471 0.1
472 0.08
473 0.07
474 0.07
475 0.08
476 0.09
477 0.08
478 0.11
479 0.12
480 0.13
481 0.18
482 0.21
483 0.25
484 0.28
485 0.28
486 0.27
487 0.27
488 0.26
489 0.22
490 0.19
491 0.12
492 0.09
493 0.08
494 0.11
495 0.12
496 0.12
497 0.11
498 0.1
499 0.11
500 0.14
501 0.16
502 0.14
503 0.12
504 0.11