Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YZ88

Protein Details
Accession A0A316YZ88    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
251-276YADGWSKPRRSNKHGNRKRGGSKSGRBasic
NLS Segment(s)
PositionSequence
257-276KPRRSNKHGNRKRGGSKSGR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MAWPGSNYYGAFDAYPPPPGAGGGGGGAGPPPGGPPGGQPSQPPPGSQQQAQQQQQQQQQQMAQHASRSAYPPPAPPQQYPPQPPAAAGGYGYPPAGYPGAEYGAPAPGGAPGGWPPYGAPQGYGHGFASSPWGAPPPWSAPSAQNPYGSPSQPPFYPRGRVPPPPFSPPTSAPMQGWGSPYGGYDPRMGAYGGMGGMPPPWAAQAAAYGQYGPHGGLGLGTGAQGMMSPYGHYGGGAVPPHIQASIARGYADGWSKPRRSNKHGNRKRGGSKSGRSSSSSSSDSESGSQKSKKTSNGKRIQDAMLGAVTGAMLEKGLEHWKDRKDKDTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.19
4 0.18
5 0.17
6 0.17
7 0.16
8 0.12
9 0.11
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.05
17 0.04
18 0.05
19 0.06
20 0.06
21 0.07
22 0.1
23 0.17
24 0.21
25 0.22
26 0.24
27 0.28
28 0.37
29 0.37
30 0.35
31 0.33
32 0.39
33 0.43
34 0.43
35 0.44
36 0.45
37 0.54
38 0.57
39 0.59
40 0.56
41 0.59
42 0.64
43 0.65
44 0.59
45 0.53
46 0.52
47 0.48
48 0.47
49 0.44
50 0.38
51 0.32
52 0.3
53 0.28
54 0.26
55 0.26
56 0.23
57 0.24
58 0.25
59 0.28
60 0.32
61 0.4
62 0.41
63 0.41
64 0.45
65 0.48
66 0.55
67 0.55
68 0.53
69 0.51
70 0.46
71 0.44
72 0.4
73 0.33
74 0.24
75 0.2
76 0.17
77 0.12
78 0.12
79 0.12
80 0.09
81 0.07
82 0.08
83 0.08
84 0.07
85 0.06
86 0.07
87 0.09
88 0.08
89 0.09
90 0.08
91 0.09
92 0.08
93 0.08
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.08
101 0.08
102 0.08
103 0.08
104 0.11
105 0.13
106 0.13
107 0.13
108 0.12
109 0.14
110 0.15
111 0.16
112 0.13
113 0.11
114 0.11
115 0.09
116 0.13
117 0.11
118 0.1
119 0.09
120 0.1
121 0.1
122 0.11
123 0.13
124 0.12
125 0.14
126 0.14
127 0.15
128 0.17
129 0.24
130 0.3
131 0.29
132 0.27
133 0.26
134 0.29
135 0.3
136 0.28
137 0.22
138 0.18
139 0.18
140 0.18
141 0.2
142 0.2
143 0.2
144 0.24
145 0.23
146 0.3
147 0.33
148 0.4
149 0.42
150 0.47
151 0.47
152 0.49
153 0.5
154 0.44
155 0.44
156 0.37
157 0.36
158 0.3
159 0.28
160 0.22
161 0.23
162 0.22
163 0.19
164 0.19
165 0.16
166 0.14
167 0.13
168 0.13
169 0.12
170 0.11
171 0.11
172 0.11
173 0.1
174 0.1
175 0.11
176 0.1
177 0.08
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.06
193 0.07
194 0.08
195 0.08
196 0.08
197 0.07
198 0.08
199 0.08
200 0.07
201 0.06
202 0.04
203 0.04
204 0.04
205 0.05
206 0.04
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.04
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.1
224 0.1
225 0.1
226 0.1
227 0.11
228 0.11
229 0.11
230 0.1
231 0.07
232 0.11
233 0.13
234 0.13
235 0.12
236 0.12
237 0.13
238 0.16
239 0.18
240 0.17
241 0.19
242 0.26
243 0.3
244 0.37
245 0.46
246 0.51
247 0.57
248 0.66
249 0.72
250 0.76
251 0.82
252 0.86
253 0.85
254 0.85
255 0.86
256 0.83
257 0.81
258 0.78
259 0.77
260 0.77
261 0.75
262 0.69
263 0.63
264 0.59
265 0.54
266 0.5
267 0.44
268 0.35
269 0.32
270 0.3
271 0.28
272 0.28
273 0.27
274 0.25
275 0.3
276 0.33
277 0.32
278 0.38
279 0.42
280 0.48
281 0.55
282 0.63
283 0.67
284 0.73
285 0.77
286 0.77
287 0.76
288 0.69
289 0.62
290 0.52
291 0.43
292 0.33
293 0.26
294 0.18
295 0.13
296 0.1
297 0.07
298 0.06
299 0.04
300 0.03
301 0.03
302 0.04
303 0.07
304 0.14
305 0.16
306 0.21
307 0.28
308 0.37
309 0.47
310 0.51
311 0.59