Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZJU0

Protein Details
Accession A0A316ZJU0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-38ISHNEPSLRPRRQHRRRSRGADGQPGBasic
NLS Segment(s)
PositionSequence
21-31RPRRQHRRRSR
60-65GARRHG
Subcellular Location(s) nucl 9, mito 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences FHFSLPLSHLTLISHNEPSLRPRRQHRRRSRGADGQPGAQPEGLGCAVLRRLQDRRGPEGARRHGAQPRQAGGLLRRRLSAHPSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.19
4 0.2
5 0.26
6 0.33
7 0.36
8 0.39
9 0.48
10 0.59
11 0.68
12 0.78
13 0.82
14 0.84
15 0.87
16 0.89
17 0.87
18 0.86
19 0.81
20 0.79
21 0.69
22 0.61
23 0.52
24 0.44
25 0.36
26 0.26
27 0.2
28 0.1
29 0.11
30 0.08
31 0.06
32 0.05
33 0.05
34 0.06
35 0.08
36 0.09
37 0.11
38 0.14
39 0.19
40 0.24
41 0.28
42 0.33
43 0.37
44 0.38
45 0.42
46 0.48
47 0.5
48 0.5
49 0.48
50 0.47
51 0.47
52 0.51
53 0.51
54 0.47
55 0.43
56 0.41
57 0.41
58 0.39
59 0.39
60 0.44
61 0.43
62 0.38
63 0.38
64 0.39
65 0.41