Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZCW3

Protein Details
Accession A0A316ZCW3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-188GTRVPSRWDGRSPRKPNRKRPRGQQBasic
NLS Segment(s)
PositionSequence
172-186DGRSPRKPNRKRPRG
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHTARWPAMTFPFRRPCRVRGSKLCADVRESCPRTGSCRAGCGLGSPSALAEALARRQRSIARVLSHRGPGFWRCTSQAAPISGAAATSPRSELSLLAKRISCSVDGVQHHAARSRAPACRKEPVLYPLASCPPRSLTGDGGALFGGTPHPSVIQAPSRHAHDGTRVPSRWDGRSPRKPNRKRPRGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.6
4 0.64
5 0.7
6 0.71
7 0.71
8 0.76
9 0.74
10 0.77
11 0.76
12 0.67
13 0.62
14 0.58
15 0.54
16 0.56
17 0.51
18 0.44
19 0.43
20 0.42
21 0.43
22 0.44
23 0.45
24 0.36
25 0.37
26 0.36
27 0.34
28 0.32
29 0.28
30 0.24
31 0.18
32 0.16
33 0.13
34 0.12
35 0.11
36 0.1
37 0.08
38 0.07
39 0.07
40 0.13
41 0.17
42 0.18
43 0.18
44 0.2
45 0.22
46 0.24
47 0.28
48 0.27
49 0.28
50 0.31
51 0.35
52 0.37
53 0.39
54 0.37
55 0.31
56 0.29
57 0.28
58 0.29
59 0.27
60 0.25
61 0.22
62 0.25
63 0.25
64 0.26
65 0.26
66 0.22
67 0.21
68 0.19
69 0.18
70 0.15
71 0.13
72 0.09
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.12
82 0.18
83 0.18
84 0.2
85 0.2
86 0.2
87 0.21
88 0.21
89 0.16
90 0.12
91 0.12
92 0.16
93 0.16
94 0.2
95 0.22
96 0.22
97 0.22
98 0.22
99 0.22
100 0.17
101 0.21
102 0.21
103 0.23
104 0.28
105 0.34
106 0.35
107 0.41
108 0.43
109 0.4
110 0.41
111 0.39
112 0.37
113 0.32
114 0.29
115 0.25
116 0.3
117 0.29
118 0.25
119 0.23
120 0.22
121 0.24
122 0.26
123 0.25
124 0.2
125 0.21
126 0.23
127 0.22
128 0.19
129 0.16
130 0.13
131 0.11
132 0.09
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.09
140 0.13
141 0.19
142 0.21
143 0.25
144 0.28
145 0.31
146 0.33
147 0.33
148 0.3
149 0.3
150 0.35
151 0.36
152 0.42
153 0.39
154 0.41
155 0.47
156 0.5
157 0.48
158 0.49
159 0.54
160 0.56
161 0.67
162 0.73
163 0.77
164 0.84
165 0.89
166 0.92
167 0.93
168 0.93