Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z2C2

Protein Details
Accession A0A316Z2C2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-35LKRRAARARILQRRKREQPYBasic
NLS Segment(s)
PositionSequence
15-54ILKRRAARARILQRRKREQPYQHESRHKHAMRRPRGPGGR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001289  NFYA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences DEEPLYVNAKQYHRILKRRAARARILQRRKREQPYQHESRHKHAMRRPRGPGGRFLTAEEVKAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.6
4 0.66
5 0.71
6 0.75
7 0.7
8 0.68
9 0.7
10 0.74
11 0.75
12 0.77
13 0.74
14 0.76
15 0.8
16 0.81
17 0.79
18 0.77
19 0.75
20 0.75
21 0.76
22 0.75
23 0.74
24 0.74
25 0.7
26 0.67
27 0.69
28 0.62
29 0.61
30 0.58
31 0.61
32 0.62
33 0.67
34 0.67
35 0.67
36 0.72
37 0.66
38 0.7
39 0.65
40 0.62
41 0.54
42 0.5
43 0.47
44 0.4
45 0.4