Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316ZHE7

Protein Details
Accession A0A316ZHE7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38ASGKVQRHTKWPGNKHRKLSVRAHydrophilic
NLS Segment(s)
PositionSequence
25-25K
27-31PGNKH
Subcellular Location(s) extr 12, mito 11, nucl 2
Family & Domain DBs
Amino Acid Sequences MLLLCCRRAVLIARRASGKVQRHTKWPGNKHRKLSVRASGVLHLAAASAASAAGSLRAAALPLASPRPLRCACCFLLGCTRPRSSHGLLLARRFVLLLGAAAPLMRPHGSGSRSERRRVLICDLASWHLGPIQHQARSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.48
4 0.48
5 0.47
6 0.48
7 0.53
8 0.53
9 0.58
10 0.65
11 0.69
12 0.71
13 0.72
14 0.74
15 0.76
16 0.81
17 0.8
18 0.81
19 0.8
20 0.76
21 0.74
22 0.71
23 0.64
24 0.59
25 0.54
26 0.46
27 0.38
28 0.32
29 0.24
30 0.15
31 0.1
32 0.07
33 0.05
34 0.04
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.05
50 0.06
51 0.07
52 0.08
53 0.08
54 0.14
55 0.16
56 0.19
57 0.2
58 0.23
59 0.23
60 0.27
61 0.27
62 0.23
63 0.3
64 0.3
65 0.31
66 0.31
67 0.32
68 0.27
69 0.3
70 0.34
71 0.28
72 0.29
73 0.3
74 0.34
75 0.34
76 0.36
77 0.35
78 0.29
79 0.27
80 0.23
81 0.18
82 0.11
83 0.09
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.06
92 0.06
93 0.06
94 0.09
95 0.14
96 0.16
97 0.22
98 0.3
99 0.39
100 0.43
101 0.48
102 0.49
103 0.49
104 0.53
105 0.51
106 0.5
107 0.47
108 0.43
109 0.41
110 0.4
111 0.37
112 0.34
113 0.29
114 0.22
115 0.17
116 0.17
117 0.16
118 0.23
119 0.27