Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CEY8

Protein Details
Accession A1CEY8    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-125IKPGICSKFRRKHPTLGREREEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto 10.5, cyto_mito 10.332, mito 8.5, nucl 7
Family & Domain DBs
KEGG act:ACLA_091350  -  
Amino Acid Sequences MSGPRTPYPPININVLPSHPAGVDIPATKTTVGSAGSKNMGPLKIPGFRDIAVREYGEWLASNVSDETLNAAFRQASVVTLSDSFDLEHIYKDQNPEFFVGKGIKPGICSKFRRKHPTLGREREEGNSRSEGGVKNVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.31
4 0.25
5 0.24
6 0.17
7 0.17
8 0.14
9 0.13
10 0.14
11 0.13
12 0.14
13 0.14
14 0.15
15 0.14
16 0.13
17 0.12
18 0.12
19 0.12
20 0.12
21 0.13
22 0.15
23 0.16
24 0.16
25 0.18
26 0.19
27 0.17
28 0.16
29 0.17
30 0.18
31 0.22
32 0.23
33 0.24
34 0.22
35 0.22
36 0.25
37 0.23
38 0.22
39 0.17
40 0.16
41 0.14
42 0.14
43 0.14
44 0.11
45 0.1
46 0.08
47 0.07
48 0.06
49 0.07
50 0.05
51 0.06
52 0.05
53 0.05
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.08
76 0.08
77 0.1
78 0.11
79 0.15
80 0.17
81 0.16
82 0.17
83 0.19
84 0.19
85 0.17
86 0.19
87 0.18
88 0.16
89 0.18
90 0.19
91 0.18
92 0.19
93 0.25
94 0.28
95 0.34
96 0.4
97 0.48
98 0.55
99 0.65
100 0.72
101 0.71
102 0.75
103 0.78
104 0.82
105 0.82
106 0.83
107 0.78
108 0.72
109 0.69
110 0.65
111 0.62
112 0.52
113 0.46
114 0.38
115 0.34
116 0.31
117 0.33
118 0.29
119 0.26