Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316ZCA6

Protein Details
Accession A0A316ZCA6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
46-65LHAARRTRRKHITSQGQARSHydrophilic
NLS Segment(s)
PositionSequence
35-56RGRVGRRAWRELHAARRTRRKH
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MRRHLAPLGAPLHLRRSRCTTTLAAAAASSERSIRGRVGRRAWRELHAARRTRRKHITSQGQARSSRASASAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.37
4 0.39
5 0.39
6 0.42
7 0.34
8 0.33
9 0.35
10 0.31
11 0.23
12 0.18
13 0.17
14 0.13
15 0.11
16 0.08
17 0.05
18 0.06
19 0.07
20 0.08
21 0.1
22 0.16
23 0.22
24 0.28
25 0.35
26 0.42
27 0.46
28 0.51
29 0.51
30 0.47
31 0.48
32 0.47
33 0.49
34 0.49
35 0.52
36 0.54
37 0.62
38 0.64
39 0.66
40 0.71
41 0.67
42 0.68
43 0.71
44 0.75
45 0.75
46 0.81
47 0.79
48 0.76
49 0.72
50 0.65
51 0.59
52 0.49
53 0.4