Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZKT2

Protein Details
Accession A0A316ZKT2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-193AIRTRRRRDAFRPGAPRRRRPAPLRRISELBasic
NLS Segment(s)
PositionSequence
165-196IRTRRRRDAFRPGAPRRRRPAPLRRISELGLR
205-208KRLR
Subcellular Location(s) mito 19, extr 4, nucl 2
Family & Domain DBs
Amino Acid Sequences MGRSRASGGCQAATRVALRTWARGVSTSGRGTIPHLSASLSGAPLFAASLLWVLLHLRSHAAAVSKALASPPRLCLAELGAAPAFRLGRRRLPWAAAQQSGVLCAHVEKRHQGPGGARSRARDWPPFAAGNVRGVGHHCARTCDKVQGLRRTNRRPCADAAGGAIRTRRRRDAFRPGAPRRRRPAPLRRISELGLRPLPDSGVSKRLRRIAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.18
4 0.23
5 0.23
6 0.25
7 0.26
8 0.26
9 0.26
10 0.25
11 0.28
12 0.26
13 0.3
14 0.28
15 0.27
16 0.26
17 0.25
18 0.26
19 0.27
20 0.23
21 0.18
22 0.18
23 0.16
24 0.16
25 0.18
26 0.16
27 0.12
28 0.11
29 0.09
30 0.09
31 0.08
32 0.07
33 0.05
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.1
49 0.09
50 0.09
51 0.1
52 0.1
53 0.1
54 0.11
55 0.12
56 0.13
57 0.14
58 0.15
59 0.17
60 0.17
61 0.17
62 0.16
63 0.15
64 0.16
65 0.14
66 0.14
67 0.11
68 0.11
69 0.1
70 0.11
71 0.1
72 0.08
73 0.12
74 0.13
75 0.2
76 0.23
77 0.28
78 0.29
79 0.31
80 0.35
81 0.38
82 0.39
83 0.33
84 0.31
85 0.26
86 0.25
87 0.23
88 0.18
89 0.1
90 0.07
91 0.07
92 0.1
93 0.1
94 0.11
95 0.13
96 0.15
97 0.19
98 0.2
99 0.21
100 0.2
101 0.27
102 0.33
103 0.34
104 0.33
105 0.31
106 0.33
107 0.38
108 0.38
109 0.34
110 0.31
111 0.3
112 0.33
113 0.31
114 0.28
115 0.27
116 0.23
117 0.21
118 0.18
119 0.15
120 0.13
121 0.14
122 0.17
123 0.16
124 0.18
125 0.17
126 0.2
127 0.23
128 0.27
129 0.28
130 0.28
131 0.29
132 0.34
133 0.41
134 0.47
135 0.53
136 0.57
137 0.64
138 0.7
139 0.75
140 0.77
141 0.74
142 0.67
143 0.62
144 0.61
145 0.53
146 0.43
147 0.38
148 0.33
149 0.29
150 0.26
151 0.27
152 0.25
153 0.31
154 0.35
155 0.41
156 0.42
157 0.5
158 0.57
159 0.65
160 0.69
161 0.71
162 0.77
163 0.79
164 0.83
165 0.85
166 0.86
167 0.82
168 0.82
169 0.81
170 0.8
171 0.81
172 0.82
173 0.83
174 0.8
175 0.78
176 0.72
177 0.65
178 0.64
179 0.57
180 0.53
181 0.47
182 0.41
183 0.36
184 0.33
185 0.32
186 0.26
187 0.26
188 0.23
189 0.29
190 0.33
191 0.37
192 0.43
193 0.49