FuNGI

A0A316ZJV2

Protein Details

Accession

A0A316ZJV2

Localization Confidence

Medium

Confidence Score

12.4

NoLS Segment(s)

Position	Sequence	Protein Nature
3-23	AQRPHSVPAHLRKKKPGHAAA	Hydrophilic

NLS Segment(s)

Position	Sequence
14-19	RKKKPG

Subcellular Location(s)

nucl 17, cyto_nucl 12, mito 5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR041723 CCT IPR004821 Cyt_trans-like IPR045049 Pcy1-like IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0004105 F:choline-phosphate cytidylyltransferase activity
Pfam	View protein in Pfam PF01467 CTP_transf_like
CDD	cd02174 CCT

Amino Acid Sequences

MAAQRPHSVPAHLRKKKPGHAAAAAPGPNGGRAGDEAFDGADHSSRDASEEDNDDISGASDSASSLRTLSRPSNASALPTSARDRALVDSNPRRPSAGASTLVNAASIGDKTPGSASPPRTGAAPRRPSQPAGKDAVSQTLERATAALSSSSGGSSDAPRAFAAPEPAAARKVSSRPKSGSSSAGSTGDGPEPGSVSASRSPTLELKSLPAPSFAQSVGPAATPRAGDAAQRAASLASGGQEEEGQASESDAARGETAASPYDGDVEYAARTPQTNAGGHHGSGAQAAGHSPAGASASLSYGTAPPDTPSHSYLGPSGTLVAQGTLPRSARAETPHSEVPVPIATNETIREYIHKAIHQPDPLRQYKINLPPDGGRNPDRPVRIYADGVYDLFHYAHSLQLRQAKLFFPCVHLIVGVVSSQSCAQHKNEPVLSSAERYASVRNCRWVDEVLEDAPWVIDQDLIDRLRIDYVAHDEAPYASKDGGSTDIYGFCKDQGRFLPTLRTPGVSTTELLGRSECWPKREQELVADMLRRSRHPVQAAQVGRQACQGSRGRQHRLSGRQCGS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.69
2	0.77
3	0.81
4	0.83
5	0.8
6	0.77
7	0.74
8	0.72
9	0.66
10	0.64
11	0.56
12	0.45
13	0.38
14	0.3
15	0.25
16	0.21
17	0.16
18	0.1
19	0.11
20	0.13
21	0.12
22	0.12
23	0.11
24	0.1
25	0.1
26	0.1
27	0.09
28	0.09
29	0.09
30	0.1
31	0.11
32	0.11
33	0.13
34	0.13
35	0.14
36	0.16
37	0.19
38	0.19
39	0.19
40	0.19
41	0.17
42	0.16
43	0.15
44	0.12
45	0.08
46	0.07
47	0.06
48	0.06
49	0.07
50	0.08
51	0.08
52	0.08
53	0.1
54	0.12
55	0.16
56	0.2
57	0.25
58	0.27
59	0.29
60	0.33
61	0.32
62	0.33
63	0.3
64	0.3
65	0.25
66	0.26
67	0.27
68	0.25
69	0.25
70	0.22
71	0.23
72	0.23
73	0.27
74	0.28
75	0.34
76	0.41
77	0.48
78	0.51
79	0.5
80	0.47
81	0.42
82	0.43
83	0.4
84	0.36
85	0.32
86	0.29
87	0.3
88	0.3
89	0.3
90	0.25
91	0.17
92	0.12
93	0.1
94	0.09
95	0.08
96	0.08
97	0.08
98	0.09
99	0.1
100	0.11
101	0.15
102	0.21
103	0.24
104	0.27
105	0.28
106	0.28
107	0.29
108	0.33
109	0.37
110	0.41
111	0.46
112	0.45
113	0.5
114	0.53
115	0.55
116	0.59
117	0.56
118	0.52
119	0.48
120	0.46
121	0.43
122	0.4
123	0.42
124	0.36
125	0.29
126	0.24
127	0.21
128	0.2
129	0.16
130	0.16
131	0.1
132	0.09
133	0.09
134	0.09
135	0.07
136	0.07
137	0.07
138	0.07
139	0.07
140	0.07
141	0.07
142	0.08
143	0.13
144	0.13
145	0.14
146	0.14
147	0.15
148	0.15
149	0.15
150	0.18
151	0.13
152	0.14
153	0.15
154	0.16
155	0.17
156	0.16
157	0.16
158	0.16
159	0.23
160	0.3
161	0.34
162	0.39
163	0.41
164	0.45
165	0.5
166	0.48
167	0.46
168	0.39
169	0.36
170	0.32
171	0.3
172	0.25
173	0.2
174	0.2
175	0.16
176	0.13
177	0.11
178	0.09
179	0.09
180	0.08
181	0.09
182	0.07
183	0.09
184	0.13
185	0.14
186	0.15
187	0.14
188	0.16
189	0.18
190	0.2
191	0.2
192	0.17
193	0.18
194	0.2
195	0.22
196	0.21
197	0.19
198	0.18
199	0.17
200	0.18
201	0.15
202	0.13
203	0.11
204	0.11
205	0.1
206	0.09
207	0.08
208	0.07
209	0.09
210	0.08
211	0.08
212	0.08
213	0.08
214	0.08
215	0.1
216	0.13
217	0.12
218	0.12
219	0.12
220	0.1
221	0.1
222	0.09
223	0.08
224	0.05
225	0.05
226	0.05
227	0.05
228	0.05
229	0.05
230	0.05
231	0.05
232	0.05
233	0.05
234	0.05
235	0.06
236	0.06
237	0.06
238	0.06
239	0.06
240	0.06
241	0.06
242	0.06
243	0.06
244	0.07
245	0.07
246	0.07
247	0.07
248	0.07
249	0.08
250	0.07
251	0.06
252	0.06
253	0.06
254	0.06
255	0.06
256	0.06
257	0.05
258	0.06
259	0.06
260	0.09
261	0.12
262	0.13
263	0.13
264	0.17
265	0.18
266	0.17
267	0.17
268	0.14
269	0.11
270	0.1
271	0.1
272	0.05
273	0.04
274	0.04
275	0.04
276	0.04
277	0.04
278	0.03
279	0.04
280	0.04
281	0.04
282	0.04
283	0.04
284	0.04
285	0.05
286	0.05
287	0.05
288	0.05
289	0.06
290	0.06
291	0.06
292	0.07
293	0.08
294	0.1
295	0.12
296	0.13
297	0.14
298	0.14
299	0.14
300	0.14
301	0.14
302	0.12
303	0.1
304	0.09
305	0.07
306	0.07
307	0.07
308	0.06
309	0.06
310	0.06
311	0.07
312	0.09
313	0.09
314	0.1
315	0.11
316	0.11
317	0.13
318	0.16
319	0.2
320	0.2
321	0.24
322	0.26
323	0.26
324	0.25
325	0.23
326	0.21
327	0.18
328	0.15
329	0.11
330	0.11
331	0.1
332	0.1
333	0.11
334	0.11
335	0.1
336	0.1
337	0.13
338	0.14
339	0.18
340	0.19
341	0.2
342	0.21
343	0.25
344	0.3
345	0.32
346	0.31
347	0.32
348	0.38
349	0.4
350	0.41
351	0.37
352	0.36
353	0.39
354	0.46
355	0.48
356	0.41
357	0.39
358	0.38
359	0.43
360	0.42
361	0.39
362	0.33
363	0.29
364	0.32
365	0.35
366	0.34
367	0.32
368	0.32
369	0.33
370	0.31
371	0.3
372	0.27
373	0.25
374	0.23
375	0.21
376	0.18
377	0.13
378	0.12
379	0.1
380	0.09
381	0.08
382	0.07
383	0.11
384	0.11
385	0.12
386	0.15
387	0.21
388	0.22
389	0.22
390	0.24
391	0.23
392	0.24
393	0.29
394	0.26
395	0.24
396	0.24
397	0.24
398	0.23
399	0.2
400	0.18
401	0.13
402	0.12
403	0.08
404	0.07
405	0.05
406	0.06
407	0.07
408	0.09
409	0.1
410	0.13
411	0.15
412	0.23
413	0.26
414	0.32
415	0.34
416	0.32
417	0.33
418	0.35
419	0.33
420	0.28
421	0.26
422	0.21
423	0.19
424	0.19
425	0.22
426	0.24
427	0.31
428	0.32
429	0.38
430	0.39
431	0.4
432	0.41
433	0.38
434	0.34
435	0.29
436	0.28
437	0.21
438	0.2
439	0.17
440	0.15
441	0.13
442	0.1
443	0.08
444	0.05
445	0.06
446	0.06
447	0.08
448	0.13
449	0.14
450	0.14
451	0.14
452	0.15
453	0.15
454	0.15
455	0.13
456	0.1
457	0.16
458	0.19
459	0.18
460	0.18
461	0.17
462	0.18
463	0.2
464	0.18
465	0.14
466	0.11
467	0.11
468	0.11
469	0.12
470	0.14
471	0.13
472	0.14
473	0.14
474	0.19
475	0.2
476	0.21
477	0.2
478	0.2
479	0.26
480	0.24
481	0.28
482	0.3
483	0.34
484	0.35
485	0.37
486	0.43
487	0.38
488	0.45
489	0.4
490	0.37
491	0.32
492	0.32
493	0.35
494	0.28
495	0.26
496	0.22
497	0.25
498	0.23
499	0.23
500	0.2
501	0.17
502	0.21
503	0.29
504	0.3
505	0.31
506	0.34
507	0.37
508	0.44
509	0.48
510	0.45
511	0.42
512	0.44
513	0.44
514	0.43
515	0.43
516	0.37
517	0.36
518	0.37
519	0.32
520	0.35
521	0.37
522	0.41
523	0.43
524	0.49
525	0.51
526	0.57
527	0.59
528	0.55
529	0.54
530	0.47
531	0.42
532	0.4
533	0.35
534	0.26
535	0.31
536	0.34
537	0.37
538	0.46
539	0.54
540	0.59
541	0.62
542	0.7
543	0.71
544	0.75
545	0.76

A0A316ZJV2

3D AlphaFold-predicted Structure Viewer