Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z4S1

Protein Details
Accession A0A316Z4S1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-34VVSSPRGRARRRNHRSQLASEREHydrophilic
NLS Segment(s)
PositionSequence
17-23RGRARRR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MGARPRPWAAAVVSSPRGRARRRNHRSQLASEREPAESASSTLVSLMRLRPAPNGAAVGAARPRPRARDALRDSLSRRVLMASLSARMQSLVGLVPLESQYRAARSPSFVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.35
4 0.41
5 0.41
6 0.48
7 0.53
8 0.59
9 0.68
10 0.76
11 0.8
12 0.83
13 0.83
14 0.82
15 0.81
16 0.77
17 0.71
18 0.63
19 0.55
20 0.45
21 0.4
22 0.32
23 0.24
24 0.16
25 0.14
26 0.11
27 0.1
28 0.09
29 0.09
30 0.09
31 0.07
32 0.08
33 0.08
34 0.1
35 0.11
36 0.12
37 0.13
38 0.14
39 0.14
40 0.13
41 0.12
42 0.1
43 0.09
44 0.09
45 0.08
46 0.09
47 0.11
48 0.11
49 0.14
50 0.15
51 0.18
52 0.21
53 0.28
54 0.3
55 0.38
56 0.43
57 0.49
58 0.5
59 0.51
60 0.5
61 0.49
62 0.47
63 0.37
64 0.32
65 0.23
66 0.21
67 0.18
68 0.19
69 0.13
70 0.13
71 0.13
72 0.13
73 0.13
74 0.12
75 0.12
76 0.08
77 0.08
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.1
85 0.09
86 0.11
87 0.13
88 0.16
89 0.18
90 0.2
91 0.21
92 0.26