Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316ZBF9

Protein Details
Accession A0A316ZBF9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-105IEKRGSTKSCKAKTNKSKNKKSQAAKKAAEHydrophilic
112-132DTKAVKKQKTEHKTEQKSQKTHydrophilic
NLS Segment(s)
PositionSequence
86-110KAKTNKSKNKKSQAAKKAAEQASAK
117-117K
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR023346  Lysozyme-like_dom_sf  
IPR008258  Transglycosylase_SLT_dom_1  
Pfam View protein in Pfam  
PF01464  SLT  
CDD cd00254  LT-like  
Amino Acid Sequences MKFSALVSLAVVAMGASSALGSLYDADALPNGVALPRRSRHPLSEQRRRALVDTYYAQHPEEARRDLADADADAEIEKRGSTKSCKAKTNKSKNKKSQAAKKAAEQASAKTDTKAVKKQKTEHKTEQKSQKTEEKSTSSSSSSNNDASGSKGLFGMRFAGQCTDPGASDEYPNGNINFLNCGVSKQNPNSKWKAPNVKLSDLRVISAHQAAQSATFKPCAKYEGAFSAAEKATGVPAVLLMSFAMQESTCNPSVTGGNGEIGMMQLTPDKCGGINCWDAATNIMTGAKYFKTEYDNRGQNVLAAAGAYNGWQDGQLSYNSATNKQWGCNAQNNLDYLNQLFNGWCQGKTGYDLKVYNNLGSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.03
6 0.03
7 0.03
8 0.03
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.07
17 0.07
18 0.06
19 0.08
20 0.12
21 0.14
22 0.22
23 0.24
24 0.3
25 0.37
26 0.41
27 0.45
28 0.52
29 0.61
30 0.64
31 0.72
32 0.75
33 0.73
34 0.74
35 0.7
36 0.61
37 0.56
38 0.47
39 0.42
40 0.38
41 0.35
42 0.34
43 0.33
44 0.31
45 0.28
46 0.28
47 0.28
48 0.3
49 0.3
50 0.28
51 0.27
52 0.28
53 0.26
54 0.25
55 0.19
56 0.13
57 0.12
58 0.11
59 0.1
60 0.09
61 0.09
62 0.08
63 0.07
64 0.07
65 0.06
66 0.08
67 0.12
68 0.18
69 0.27
70 0.37
71 0.43
72 0.52
73 0.59
74 0.68
75 0.75
76 0.81
77 0.83
78 0.84
79 0.88
80 0.9
81 0.93
82 0.92
83 0.9
84 0.89
85 0.88
86 0.88
87 0.79
88 0.74
89 0.73
90 0.65
91 0.61
92 0.51
93 0.43
94 0.38
95 0.41
96 0.35
97 0.26
98 0.28
99 0.28
100 0.33
101 0.39
102 0.43
103 0.46
104 0.52
105 0.6
106 0.67
107 0.7
108 0.74
109 0.76
110 0.77
111 0.77
112 0.8
113 0.82
114 0.8
115 0.75
116 0.71
117 0.68
118 0.63
119 0.6
120 0.56
121 0.51
122 0.45
123 0.44
124 0.42
125 0.35
126 0.31
127 0.28
128 0.25
129 0.23
130 0.21
131 0.18
132 0.17
133 0.16
134 0.15
135 0.16
136 0.13
137 0.1
138 0.11
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.1
146 0.11
147 0.11
148 0.11
149 0.12
150 0.1
151 0.09
152 0.09
153 0.11
154 0.1
155 0.1
156 0.11
157 0.1
158 0.11
159 0.12
160 0.11
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.09
169 0.1
170 0.12
171 0.16
172 0.19
173 0.26
174 0.28
175 0.34
176 0.38
177 0.42
178 0.46
179 0.5
180 0.56
181 0.52
182 0.57
183 0.56
184 0.57
185 0.54
186 0.5
187 0.49
188 0.38
189 0.35
190 0.27
191 0.22
192 0.18
193 0.16
194 0.14
195 0.09
196 0.1
197 0.09
198 0.11
199 0.12
200 0.12
201 0.12
202 0.15
203 0.16
204 0.17
205 0.18
206 0.18
207 0.18
208 0.17
209 0.18
210 0.18
211 0.19
212 0.18
213 0.18
214 0.2
215 0.19
216 0.18
217 0.15
218 0.12
219 0.1
220 0.1
221 0.09
222 0.04
223 0.04
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.06
235 0.11
236 0.12
237 0.13
238 0.13
239 0.14
240 0.14
241 0.15
242 0.16
243 0.12
244 0.11
245 0.1
246 0.1
247 0.09
248 0.08
249 0.07
250 0.05
251 0.04
252 0.08
253 0.08
254 0.1
255 0.1
256 0.1
257 0.11
258 0.12
259 0.14
260 0.14
261 0.16
262 0.16
263 0.16
264 0.16
265 0.16
266 0.17
267 0.15
268 0.11
269 0.09
270 0.1
271 0.09
272 0.09
273 0.11
274 0.1
275 0.11
276 0.12
277 0.14
278 0.2
279 0.25
280 0.3
281 0.37
282 0.43
283 0.43
284 0.44
285 0.42
286 0.36
287 0.32
288 0.26
289 0.16
290 0.1
291 0.09
292 0.07
293 0.07
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.06
300 0.06
301 0.08
302 0.09
303 0.11
304 0.12
305 0.16
306 0.17
307 0.2
308 0.2
309 0.25
310 0.28
311 0.27
312 0.32
313 0.35
314 0.39
315 0.45
316 0.49
317 0.47
318 0.47
319 0.46
320 0.43
321 0.37
322 0.33
323 0.25
324 0.23
325 0.18
326 0.15
327 0.15
328 0.13
329 0.21
330 0.21
331 0.2
332 0.2
333 0.21
334 0.22
335 0.26
336 0.3
337 0.25
338 0.3
339 0.32
340 0.33
341 0.4
342 0.41