Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z341

Protein Details
Accession A0A316Z341    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-229ARRMSPAESQRRRPGRRRRWVHSRGSRQPQRQGKRSRAAAGHydrophilic
NLS Segment(s)
PositionSequence
195-237AESQRRRPGRRRRWVHSRGSRQPQRQGKRSRAAAGARSRPNKP
Subcellular Location(s) mito 13, nucl 8, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MRVRRWCWLRGASSCSVRRRAKLQQPAATGGGARSTRRVECTASRVRLLPAARRRPLLPCATQAGRARHTRTASRRAQASFAPLMPLLHLRNPESSGTELRRGARQLSSLVPVREPRRCALQPMTASRLGCVAACCAVGAAAAALGRPIRCSSSYRRGCLAAHPRHSMLPSRSLRQRSLQLAQPATEPARRMSPAESQRRRPGRRRRWVHSRGSRQPQRQGKRSRAAAGARSRPNKPCAARFARAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.62
3 0.64
4 0.62
5 0.61
6 0.62
7 0.65
8 0.66
9 0.7
10 0.73
11 0.7
12 0.69
13 0.68
14 0.62
15 0.52
16 0.42
17 0.32
18 0.28
19 0.23
20 0.2
21 0.2
22 0.23
23 0.25
24 0.28
25 0.31
26 0.29
27 0.32
28 0.4
29 0.45
30 0.44
31 0.44
32 0.41
33 0.4
34 0.4
35 0.38
36 0.39
37 0.4
38 0.47
39 0.48
40 0.49
41 0.5
42 0.49
43 0.53
44 0.5
45 0.43
46 0.37
47 0.39
48 0.38
49 0.43
50 0.44
51 0.43
52 0.42
53 0.45
54 0.45
55 0.45
56 0.47
57 0.49
58 0.5
59 0.54
60 0.55
61 0.54
62 0.55
63 0.51
64 0.49
65 0.42
66 0.39
67 0.32
68 0.26
69 0.22
70 0.18
71 0.16
72 0.15
73 0.17
74 0.13
75 0.13
76 0.15
77 0.15
78 0.16
79 0.18
80 0.18
81 0.17
82 0.18
83 0.19
84 0.2
85 0.22
86 0.23
87 0.22
88 0.24
89 0.24
90 0.24
91 0.2
92 0.19
93 0.17
94 0.17
95 0.19
96 0.19
97 0.19
98 0.18
99 0.22
100 0.24
101 0.26
102 0.27
103 0.24
104 0.29
105 0.29
106 0.31
107 0.3
108 0.32
109 0.32
110 0.33
111 0.35
112 0.3
113 0.29
114 0.25
115 0.22
116 0.17
117 0.14
118 0.11
119 0.08
120 0.06
121 0.06
122 0.06
123 0.05
124 0.04
125 0.04
126 0.03
127 0.03
128 0.02
129 0.02
130 0.02
131 0.03
132 0.04
133 0.04
134 0.05
135 0.06
136 0.08
137 0.09
138 0.13
139 0.21
140 0.31
141 0.36
142 0.38
143 0.39
144 0.39
145 0.38
146 0.43
147 0.46
148 0.43
149 0.43
150 0.43
151 0.43
152 0.42
153 0.43
154 0.41
155 0.33
156 0.35
157 0.33
158 0.36
159 0.41
160 0.44
161 0.45
162 0.44
163 0.48
164 0.44
165 0.45
166 0.45
167 0.44
168 0.42
169 0.4
170 0.36
171 0.32
172 0.29
173 0.27
174 0.23
175 0.18
176 0.21
177 0.22
178 0.22
179 0.22
180 0.29
181 0.36
182 0.46
183 0.52
184 0.55
185 0.64
186 0.73
187 0.78
188 0.79
189 0.81
190 0.81
191 0.85
192 0.87
193 0.86
194 0.87
195 0.88
196 0.89
197 0.88
198 0.88
199 0.87
200 0.89
201 0.89
202 0.86
203 0.87
204 0.86
205 0.85
206 0.84
207 0.84
208 0.82
209 0.82
210 0.81
211 0.76
212 0.73
213 0.69
214 0.68
215 0.67
216 0.67
217 0.66
218 0.67
219 0.67
220 0.66
221 0.66
222 0.66
223 0.63
224 0.62
225 0.63
226 0.65
227 0.64