Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z465

Protein Details
Accession A0A316Z465    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-34RASAAASRARRRPPRCQGGAHydrophilic
NLS Segment(s)
PositionSequence
13-29RSRASAAASRARRRPPR
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
Amino Acid Sequences MPAWPVRAAPSGRSRASAAASRARRRPPRCQGGATLWARVGHKRRRSHTSTITSWCRRYRTDGMLHSQPQTHTAPRAAECPQTTLCAASGTHKACTHPHPPHLPAHNHLTMSAFSSAPPPYDAAHGALPQAQADTMPSGSKSWTQLVRGTHDELYAAWDSGMLGADAPQHVRGRSLALRTDGNQFHWSEWLQSITWHERAFGPAQSVMTFATRMFRSDSFEMQAAGSSRTLASWKERTGALTIGKQKLTVQADEGLQSAAVQLDGRACRWECVGELVSCRAGAAARQCADGISQRTVDGHRWDKCTYGLYDTQSREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.41
4 0.41
5 0.37
6 0.39
7 0.46
8 0.51
9 0.57
10 0.64
11 0.7
12 0.71
13 0.77
14 0.78
15 0.8
16 0.79
17 0.77
18 0.73
19 0.69
20 0.72
21 0.63
22 0.54
23 0.45
24 0.42
25 0.39
26 0.41
27 0.43
28 0.43
29 0.5
30 0.57
31 0.62
32 0.68
33 0.73
34 0.75
35 0.75
36 0.74
37 0.71
38 0.71
39 0.74
40 0.7
41 0.7
42 0.67
43 0.61
44 0.55
45 0.57
46 0.55
47 0.53
48 0.55
49 0.54
50 0.55
51 0.58
52 0.58
53 0.53
54 0.48
55 0.41
56 0.37
57 0.34
58 0.3
59 0.26
60 0.26
61 0.28
62 0.26
63 0.29
64 0.27
65 0.29
66 0.27
67 0.28
68 0.26
69 0.24
70 0.23
71 0.2
72 0.18
73 0.15
74 0.14
75 0.13
76 0.19
77 0.19
78 0.21
79 0.22
80 0.23
81 0.25
82 0.31
83 0.37
84 0.36
85 0.41
86 0.43
87 0.45
88 0.51
89 0.54
90 0.52
91 0.46
92 0.48
93 0.43
94 0.38
95 0.35
96 0.3
97 0.23
98 0.22
99 0.2
100 0.13
101 0.1
102 0.13
103 0.13
104 0.12
105 0.12
106 0.11
107 0.1
108 0.11
109 0.12
110 0.11
111 0.12
112 0.11
113 0.11
114 0.12
115 0.11
116 0.1
117 0.09
118 0.07
119 0.06
120 0.06
121 0.07
122 0.05
123 0.05
124 0.06
125 0.06
126 0.07
127 0.09
128 0.1
129 0.13
130 0.15
131 0.16
132 0.2
133 0.21
134 0.24
135 0.25
136 0.25
137 0.22
138 0.2
139 0.18
140 0.15
141 0.16
142 0.12
143 0.1
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.03
150 0.03
151 0.03
152 0.04
153 0.04
154 0.05
155 0.07
156 0.08
157 0.08
158 0.09
159 0.09
160 0.12
161 0.15
162 0.17
163 0.16
164 0.17
165 0.18
166 0.19
167 0.25
168 0.22
169 0.23
170 0.23
171 0.22
172 0.2
173 0.21
174 0.2
175 0.15
176 0.15
177 0.14
178 0.11
179 0.11
180 0.15
181 0.17
182 0.19
183 0.18
184 0.18
185 0.17
186 0.19
187 0.2
188 0.17
189 0.15
190 0.14
191 0.14
192 0.13
193 0.13
194 0.11
195 0.1
196 0.1
197 0.08
198 0.12
199 0.11
200 0.12
201 0.15
202 0.15
203 0.2
204 0.22
205 0.24
206 0.21
207 0.22
208 0.21
209 0.18
210 0.19
211 0.14
212 0.13
213 0.11
214 0.1
215 0.09
216 0.09
217 0.1
218 0.1
219 0.16
220 0.19
221 0.2
222 0.22
223 0.23
224 0.24
225 0.25
226 0.27
227 0.24
228 0.25
229 0.31
230 0.33
231 0.33
232 0.32
233 0.31
234 0.34
235 0.34
236 0.29
237 0.24
238 0.23
239 0.23
240 0.24
241 0.23
242 0.16
243 0.12
244 0.11
245 0.09
246 0.06
247 0.06
248 0.05
249 0.05
250 0.1
251 0.11
252 0.12
253 0.17
254 0.18
255 0.19
256 0.2
257 0.21
258 0.16
259 0.21
260 0.23
261 0.2
262 0.22
263 0.23
264 0.22
265 0.21
266 0.2
267 0.15
268 0.12
269 0.14
270 0.17
271 0.22
272 0.22
273 0.23
274 0.24
275 0.23
276 0.25
277 0.29
278 0.27
279 0.23
280 0.23
281 0.23
282 0.25
283 0.27
284 0.3
285 0.33
286 0.37
287 0.39
288 0.43
289 0.44
290 0.44
291 0.44
292 0.43
293 0.37
294 0.35
295 0.34
296 0.35
297 0.42