Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZFP1

Protein Details
Accession A0A316ZFP1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
262-292PVVVVRPEAKVRKHRKKRQEDPKRRSYHDLVBasic
NLS Segment(s)
PositionSequence
269-286EAKVRKHRKKRQEDPKRR
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006016  UspA  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MASASAPGSEMPSPPHSPPLHRDSAVTFLPQLAPSQTHASSGPSSIAPSALSAPSSASSRSRSPGPTGIKMPSRAAGGSLGGLSEKGGAWERKVGFDTMPDADETVSGEFSYTLQVKSRGYRRTKNTRTFMCAFDTNAYSERALEWLMESLVEDGDEVVALRVLEGEADSIDQDEAREEARELIDSIVDLNDDVEERRISIVVEFVAGDSVTSTVLRMIHVYRPDSLTVGTRGKTPNAFAKLLGGASMGSVSREILSRSPVPVVVVRPEAKVRKHRKKRQEDPKRRSYHDLVAKAHSLPLSRDSSHQEPSRFHGHAHFSHDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.35
4 0.39
5 0.45
6 0.48
7 0.5
8 0.46
9 0.46
10 0.4
11 0.43
12 0.39
13 0.33
14 0.26
15 0.2
16 0.22
17 0.2
18 0.19
19 0.16
20 0.16
21 0.17
22 0.22
23 0.21
24 0.21
25 0.21
26 0.23
27 0.22
28 0.21
29 0.2
30 0.15
31 0.16
32 0.14
33 0.14
34 0.11
35 0.11
36 0.12
37 0.11
38 0.11
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.14
45 0.18
46 0.21
47 0.23
48 0.27
49 0.28
50 0.31
51 0.38
52 0.41
53 0.42
54 0.42
55 0.45
56 0.45
57 0.45
58 0.42
59 0.36
60 0.31
61 0.26
62 0.24
63 0.19
64 0.15
65 0.12
66 0.11
67 0.08
68 0.07
69 0.07
70 0.06
71 0.05
72 0.05
73 0.06
74 0.11
75 0.12
76 0.13
77 0.19
78 0.2
79 0.21
80 0.23
81 0.23
82 0.18
83 0.19
84 0.2
85 0.15
86 0.15
87 0.13
88 0.12
89 0.11
90 0.1
91 0.1
92 0.08
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.09
99 0.09
100 0.09
101 0.11
102 0.13
103 0.15
104 0.21
105 0.28
106 0.33
107 0.39
108 0.47
109 0.54
110 0.63
111 0.71
112 0.75
113 0.75
114 0.71
115 0.71
116 0.65
117 0.58
118 0.51
119 0.42
120 0.34
121 0.28
122 0.25
123 0.19
124 0.18
125 0.17
126 0.13
127 0.12
128 0.11
129 0.09
130 0.08
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.06
167 0.07
168 0.07
169 0.07
170 0.07
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.06
191 0.06
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.06
204 0.08
205 0.09
206 0.13
207 0.17
208 0.18
209 0.19
210 0.2
211 0.2
212 0.2
213 0.19
214 0.17
215 0.18
216 0.2
217 0.19
218 0.21
219 0.22
220 0.24
221 0.25
222 0.25
223 0.28
224 0.3
225 0.3
226 0.26
227 0.27
228 0.25
229 0.24
230 0.21
231 0.13
232 0.08
233 0.07
234 0.08
235 0.06
236 0.05
237 0.05
238 0.06
239 0.06
240 0.07
241 0.09
242 0.1
243 0.15
244 0.16
245 0.17
246 0.18
247 0.18
248 0.19
249 0.2
250 0.21
251 0.2
252 0.24
253 0.24
254 0.25
255 0.32
256 0.36
257 0.4
258 0.49
259 0.56
260 0.62
261 0.72
262 0.8
263 0.85
264 0.9
265 0.93
266 0.94
267 0.95
268 0.95
269 0.93
270 0.93
271 0.91
272 0.85
273 0.82
274 0.77
275 0.75
276 0.73
277 0.71
278 0.64
279 0.6
280 0.57
281 0.49
282 0.45
283 0.37
284 0.3
285 0.24
286 0.27
287 0.27
288 0.26
289 0.3
290 0.35
291 0.38
292 0.44
293 0.48
294 0.46
295 0.44
296 0.48
297 0.53
298 0.46
299 0.43
300 0.42
301 0.43
302 0.43
303 0.48
304 0.46