Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZBK0

Protein Details
Accession A0A316ZBK0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-125GQVHRPAPRRRRLCRSRCCPPTRSWTWRRRSRRAPAARAGLRHydrophilic
NLS Segment(s)
PositionSequence
111-125RRRSRRAPAARAGLR
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MLTSRPLRRRPSRAWASCCGSRPTHRSAPAASSPRPPAAPGALGAPAVRFVRRLPRADWRRACRARPSLCSGALAPSRQACVAGQVHRPAPRRRRLCRSRCCPPTRSWTWRRRSRRAPAARAGLRSVQMKPAPALLPPSRRSATSRSAARPHLAACCATASVRAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.75
4 0.71
5 0.67
6 0.61
7 0.55
8 0.53
9 0.52
10 0.52
11 0.53
12 0.52
13 0.51
14 0.49
15 0.5
16 0.51
17 0.52
18 0.46
19 0.44
20 0.43
21 0.42
22 0.4
23 0.35
24 0.28
25 0.24
26 0.23
27 0.17
28 0.16
29 0.13
30 0.13
31 0.12
32 0.1
33 0.11
34 0.11
35 0.1
36 0.09
37 0.1
38 0.2
39 0.26
40 0.29
41 0.29
42 0.39
43 0.46
44 0.56
45 0.63
46 0.59
47 0.64
48 0.66
49 0.67
50 0.64
51 0.66
52 0.61
53 0.57
54 0.58
55 0.51
56 0.46
57 0.44
58 0.35
59 0.31
60 0.27
61 0.23
62 0.17
63 0.14
64 0.14
65 0.13
66 0.13
67 0.08
68 0.11
69 0.13
70 0.15
71 0.16
72 0.18
73 0.21
74 0.26
75 0.31
76 0.35
77 0.41
78 0.48
79 0.55
80 0.6
81 0.68
82 0.74
83 0.79
84 0.81
85 0.81
86 0.82
87 0.83
88 0.81
89 0.74
90 0.69
91 0.68
92 0.66
93 0.67
94 0.67
95 0.66
96 0.71
97 0.77
98 0.82
99 0.82
100 0.83
101 0.84
102 0.85
103 0.85
104 0.82
105 0.8
106 0.8
107 0.74
108 0.66
109 0.59
110 0.5
111 0.43
112 0.39
113 0.32
114 0.29
115 0.27
116 0.26
117 0.24
118 0.26
119 0.23
120 0.21
121 0.27
122 0.26
123 0.33
124 0.33
125 0.39
126 0.37
127 0.38
128 0.41
129 0.4
130 0.42
131 0.43
132 0.48
133 0.48
134 0.53
135 0.55
136 0.54
137 0.5
138 0.45
139 0.41
140 0.36
141 0.29
142 0.24
143 0.22
144 0.2
145 0.18
146 0.18