Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z7T3

Protein Details
Accession A0A316Z7T3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-114QWFRLKTDNKIQYNKNRRHWRRTKLGLHydrophilic
NLS Segment(s)
PositionSequence
79-84AAKKSR
105-105R
Subcellular Location(s) nucl 14, mito_nucl 13.499, mito 11.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MSQRGSGQSTRRPGCSQEWAETLGSSSVERPLCRRGSLRVVARPPAFRPIIRLDKELIPLRRLQPSQKTFRIKSKLAVAAKKSRPIPQWFRLKTDNKIQYNKNRRHWRRTKLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.49
4 0.44
5 0.42
6 0.4
7 0.38
8 0.34
9 0.29
10 0.2
11 0.16
12 0.12
13 0.11
14 0.13
15 0.15
16 0.16
17 0.17
18 0.23
19 0.25
20 0.27
21 0.29
22 0.29
23 0.34
24 0.4
25 0.43
26 0.43
27 0.44
28 0.47
29 0.47
30 0.44
31 0.38
32 0.37
33 0.33
34 0.26
35 0.27
36 0.29
37 0.34
38 0.34
39 0.34
40 0.31
41 0.31
42 0.35
43 0.36
44 0.31
45 0.24
46 0.25
47 0.26
48 0.29
49 0.28
50 0.28
51 0.33
52 0.38
53 0.44
54 0.49
55 0.54
56 0.52
57 0.6
58 0.62
59 0.54
60 0.51
61 0.51
62 0.5
63 0.48
64 0.51
65 0.47
66 0.5
67 0.53
68 0.55
69 0.51
70 0.5
71 0.51
72 0.55
73 0.58
74 0.57
75 0.64
76 0.6
77 0.63
78 0.66
79 0.65
80 0.62
81 0.64
82 0.65
83 0.62
84 0.67
85 0.69
86 0.71
87 0.77
88 0.8
89 0.8
90 0.82
91 0.84
92 0.88
93 0.89
94 0.88