Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316ZFB0

Protein Details
Accession A0A316ZFB0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-43LMLIEHVKRRRRLRRDGTREAISHydrophilic
NLS Segment(s)
PositionSequence
28-34KRRRRLR
Subcellular Location(s) nucl 9.5, cyto_nucl 7.5, mito 6, cyto 4.5, plas 2, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MINVPDELRYYSGGCSSFTILMLIEHVKRRRRLRRDGTREAISCVLWLASKVPGLTTATCAAVRPLQLSLHQGPACAARSGTSMSLFDRRQLHLPCCDAAEREQRGVSCRLLLLQPPFCRPGAGFSHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.17
5 0.16
6 0.15
7 0.12
8 0.11
9 0.12
10 0.12
11 0.13
12 0.2
13 0.26
14 0.33
15 0.41
16 0.51
17 0.6
18 0.66
19 0.74
20 0.78
21 0.83
22 0.86
23 0.87
24 0.83
25 0.79
26 0.71
27 0.63
28 0.53
29 0.41
30 0.32
31 0.22
32 0.16
33 0.09
34 0.08
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.1
42 0.1
43 0.1
44 0.1
45 0.11
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.09
55 0.13
56 0.13
57 0.18
58 0.18
59 0.17
60 0.16
61 0.19
62 0.19
63 0.15
64 0.14
65 0.09
66 0.1
67 0.12
68 0.12
69 0.1
70 0.09
71 0.11
72 0.17
73 0.17
74 0.2
75 0.22
76 0.24
77 0.3
78 0.33
79 0.35
80 0.34
81 0.36
82 0.32
83 0.31
84 0.3
85 0.25
86 0.26
87 0.31
88 0.29
89 0.29
90 0.3
91 0.29
92 0.32
93 0.33
94 0.29
95 0.22
96 0.19
97 0.19
98 0.19
99 0.23
100 0.26
101 0.31
102 0.33
103 0.36
104 0.38
105 0.36
106 0.36
107 0.32
108 0.31