Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z3W4

Protein Details
Accession A0A316Z3W4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-127AGLAKKIEKPSRKLRKERKNRANKLRGTAKAKKBasic
NLS Segment(s)
PositionSequence
98-134AKKIEKPSRKLRKERKNRANKLRGTAKAKKSDASKKK
Subcellular Location(s) mito 22.5, mito_nucl 14, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDASSPVTLRTRKFITNRLLQRKQMVLDVIHPARANVSKAELSEKLASMYKANKEQCVVFGMRTHFGGGRSTGFALIYDSRESMNFEPRHRLVQAGLAKKIEKPSRKLRKERKNRANKLRGTAKAKKSDASKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.57
4 0.66
5 0.7
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.33
16 0.28
17 0.26
18 0.25
19 0.21
20 0.22
21 0.23
22 0.21
23 0.14
24 0.17
25 0.16
26 0.16
27 0.2
28 0.18
29 0.19
30 0.19
31 0.19
32 0.17
33 0.18
34 0.17
35 0.16
36 0.19
37 0.19
38 0.25
39 0.26
40 0.26
41 0.25
42 0.25
43 0.24
44 0.23
45 0.2
46 0.13
47 0.15
48 0.16
49 0.15
50 0.15
51 0.15
52 0.13
53 0.13
54 0.13
55 0.11
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.12
70 0.12
71 0.2
72 0.22
73 0.23
74 0.29
75 0.3
76 0.33
77 0.31
78 0.3
79 0.22
80 0.27
81 0.32
82 0.3
83 0.31
84 0.29
85 0.3
86 0.31
87 0.39
88 0.39
89 0.39
90 0.41
91 0.51
92 0.6
93 0.69
94 0.78
95 0.81
96 0.84
97 0.89
98 0.93
99 0.93
100 0.93
101 0.94
102 0.95
103 0.94
104 0.89
105 0.87
106 0.85
107 0.82
108 0.8
109 0.79
110 0.77
111 0.77
112 0.73
113 0.69
114 0.68