Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z2R6

Protein Details
Accession A0A316Z2R6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29LSNSTKTHTLCRRCNKRSFHRQHKTCASCHydrophilic
NLS Segment(s)
PositionSequence
44-71KAKRRKTTGTGRMRHLSGVPRRAKNGFR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences LSNSTKTHTLCRRCNKRSFHRQHKTCASCGYPAAKIRSYEWGQKAKRRKTTGTGRMRHLSGVPRRAKNGFRTGVATSKKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.86
5 0.87
6 0.88
7 0.88
8 0.85
9 0.85
10 0.86
11 0.79
12 0.7
13 0.64
14 0.54
15 0.45
16 0.42
17 0.35
18 0.29
19 0.28
20 0.29
21 0.27
22 0.25
23 0.25
24 0.29
25 0.29
26 0.32
27 0.33
28 0.38
29 0.39
30 0.45
31 0.53
32 0.55
33 0.61
34 0.6
35 0.59
36 0.59
37 0.67
38 0.7
39 0.71
40 0.68
41 0.65
42 0.64
43 0.61
44 0.53
45 0.45
46 0.44
47 0.41
48 0.45
49 0.47
50 0.47
51 0.51
52 0.54
53 0.57
54 0.56
55 0.58
56 0.52
57 0.46
58 0.47
59 0.46
60 0.49
61 0.47