Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YZM4

Protein Details
Accession A0A316YZM4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-58MQALPCRAKRRCGKPRGRSCSVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MCTLTRPLCAWVLAKRQRSCAAPPGERGTRRVGVPMQALPCRAKRRCGKPRGRSCSVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.49
4 0.51
5 0.52
6 0.49
7 0.47
8 0.47
9 0.4
10 0.42
11 0.43
12 0.45
13 0.43
14 0.41
15 0.37
16 0.32
17 0.3
18 0.29
19 0.24
20 0.21
21 0.22
22 0.23
23 0.22
24 0.21
25 0.23
26 0.23
27 0.29
28 0.36
29 0.36
30 0.42
31 0.48
32 0.58
33 0.67
34 0.75
35 0.79
36 0.81
37 0.9
38 0.9