Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z8V5

Protein Details
Accession A0A316Z8V5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-53LSHPAHPRDSRCRKPRTRRRARSRPPRRGRRSPRTAARPGRBasic
NLS Segment(s)
PositionSequence
23-58RCRKPRTRRRARSRPPRRGRRSPRTAARPGRARGVP
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences CTFQIQTSCGPHLSHPAHPRDSRCRKPRTRRRARSRPPRRGRRSPRTAARPGRARGVPRTSSRFSTPCSRTPGASTGTRSPPRWAAPRARCGTNGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.44
4 0.49
5 0.52
6 0.57
7 0.59
8 0.66
9 0.69
10 0.7
11 0.75
12 0.78
13 0.85
14 0.9
15 0.9
16 0.91
17 0.92
18 0.94
19 0.95
20 0.95
21 0.95
22 0.95
23 0.95
24 0.94
25 0.94
26 0.92
27 0.92
28 0.92
29 0.91
30 0.89
31 0.86
32 0.84
33 0.81
34 0.81
35 0.76
36 0.73
37 0.69
38 0.61
39 0.58
40 0.52
41 0.47
42 0.44
43 0.44
44 0.41
45 0.39
46 0.44
47 0.41
48 0.41
49 0.43
50 0.39
51 0.36
52 0.41
53 0.4
54 0.4
55 0.45
56 0.43
57 0.4
58 0.41
59 0.41
60 0.35
61 0.35
62 0.34
63 0.33
64 0.4
65 0.45
66 0.43
67 0.44
68 0.46
69 0.48
70 0.51
71 0.52
72 0.54
73 0.57
74 0.66
75 0.67
76 0.64
77 0.59