Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZGB3

Protein Details
Accession A0A316ZGB3    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-29ISRLPGARRSAPRRPCRRPALGACKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MLRISRLPGARRSAPRRPCRRPALGACKPVNVACVQALPAWCSLPASRCHTAHERWRSREGRHCSCRAATCACGAGCCERDETCLSSWKLSAQRRGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.8
4 0.82
5 0.83
6 0.82
7 0.81
8 0.8
9 0.8
10 0.8
11 0.77
12 0.77
13 0.68
14 0.61
15 0.55
16 0.46
17 0.38
18 0.27
19 0.2
20 0.12
21 0.11
22 0.1
23 0.11
24 0.11
25 0.1
26 0.1
27 0.09
28 0.09
29 0.09
30 0.09
31 0.1
32 0.14
33 0.19
34 0.22
35 0.22
36 0.26
37 0.29
38 0.33
39 0.39
40 0.46
41 0.47
42 0.47
43 0.56
44 0.56
45 0.57
46 0.62
47 0.62
48 0.62
49 0.61
50 0.6
51 0.55
52 0.54
53 0.53
54 0.47
55 0.41
56 0.32
57 0.27
58 0.28
59 0.24
60 0.21
61 0.19
62 0.2
63 0.18
64 0.18
65 0.19
66 0.16
67 0.19
68 0.21
69 0.23
70 0.21
71 0.27
72 0.27
73 0.27
74 0.27
75 0.31
76 0.36
77 0.41