Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M2B4

Protein Details
Accession E2M2B4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-71LVEDKKDRLREKRKWPEEKLPVGBasic
NLS Segment(s)
PositionSequence
60-60K
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031121  RIK/BLOM7  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
KEGG mpr:MPER_14115  -  
Amino Acid Sequences TKGTWYPDRTKATEKDPPLYLHIMAGSKESLQKAIDKVNELMSIDMGSLVEDKKDRLREKRKWPEEKLPVGLESIRNFNVRAKVVGPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.49
4 0.47
5 0.43
6 0.41
7 0.34
8 0.26
9 0.24
10 0.2
11 0.17
12 0.16
13 0.12
14 0.11
15 0.13
16 0.13
17 0.13
18 0.12
19 0.14
20 0.15
21 0.19
22 0.19
23 0.19
24 0.19
25 0.19
26 0.19
27 0.17
28 0.15
29 0.11
30 0.09
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.07
40 0.12
41 0.19
42 0.25
43 0.34
44 0.45
45 0.53
46 0.64
47 0.74
48 0.8
49 0.82
50 0.84
51 0.84
52 0.83
53 0.8
54 0.73
55 0.64
56 0.54
57 0.46
58 0.41
59 0.34
60 0.28
61 0.26
62 0.24
63 0.23
64 0.23
65 0.27
66 0.31
67 0.29
68 0.29