Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z0H4

Protein Details
Accession A0A316Z0H4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86VPSRAARSRKGPVRWRRVGAHydrophilic
NLS Segment(s)
PositionSequence
72-83ARSRKGPVRWRR
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MLRWPAERCRRWRWAQGVARETPGAPELRLRRAAARQGVTLPLLLAGCAAPEQRCVYARYLALAVLVPSRAARSRKGPVRWRRVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.74
4 0.71
5 0.63
6 0.58
7 0.5
8 0.43
9 0.33
10 0.28
11 0.2
12 0.14
13 0.18
14 0.19
15 0.23
16 0.26
17 0.26
18 0.27
19 0.3
20 0.35
21 0.34
22 0.32
23 0.29
24 0.27
25 0.27
26 0.23
27 0.19
28 0.14
29 0.09
30 0.07
31 0.06
32 0.05
33 0.04
34 0.03
35 0.04
36 0.05
37 0.04
38 0.06
39 0.08
40 0.09
41 0.11
42 0.13
43 0.15
44 0.18
45 0.18
46 0.18
47 0.17
48 0.15
49 0.14
50 0.12
51 0.11
52 0.08
53 0.08
54 0.07
55 0.07
56 0.1
57 0.15
58 0.17
59 0.21
60 0.27
61 0.37
62 0.46
63 0.55
64 0.63
65 0.68
66 0.77