Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UA60

Protein Details
Accession A0A316UA60    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
187-211PIFGPQSYKFKKRRKTQIKGSGAGRHydrophilic
NLS Segment(s)
PositionSequence
197-206KKRRKTQIKG
228-270AKQKAEAKQKAKEKAMAKATTAYKDKGKGKAVAELEPRPKMRK
Subcellular Location(s) extr 18, mito 3, nucl 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKTHKFFIPILCLLCCSTTLASSSSDSERTLSNPGSPVRHSSPRTSPTIAISAPSLTHFVRFDDIVQRPGQSTRPTRPTPTAHLVKKTREPNPNSLSAQLERSRAYFRKEREEKSSAARWTPLHKEAQRSQAVNVYVNNKPARAKPTGAGVPAGGSASPVRPLTLYFPVTSQGDPLLAGHPISEEHPIFGPQSYKFKKRRKTQIKGSGAGRGGDSDGDWTPASDRALAKQKAEAKQKAKEKAMAKATTAYKDKGKGKAVAELEPRPKMRKLIDLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.18
4 0.15
5 0.14
6 0.15
7 0.15
8 0.16
9 0.17
10 0.19
11 0.19
12 0.2
13 0.19
14 0.19
15 0.19
16 0.19
17 0.22
18 0.2
19 0.2
20 0.23
21 0.26
22 0.29
23 0.29
24 0.34
25 0.36
26 0.43
27 0.44
28 0.45
29 0.51
30 0.52
31 0.56
32 0.52
33 0.47
34 0.42
35 0.43
36 0.36
37 0.28
38 0.24
39 0.19
40 0.16
41 0.16
42 0.15
43 0.11
44 0.14
45 0.14
46 0.14
47 0.15
48 0.15
49 0.16
50 0.21
51 0.23
52 0.24
53 0.24
54 0.23
55 0.23
56 0.24
57 0.27
58 0.26
59 0.31
60 0.36
61 0.43
62 0.46
63 0.49
64 0.53
65 0.53
66 0.53
67 0.56
68 0.56
69 0.52
70 0.58
71 0.58
72 0.57
73 0.6
74 0.61
75 0.6
76 0.6
77 0.61
78 0.62
79 0.61
80 0.62
81 0.55
82 0.49
83 0.44
84 0.36
85 0.36
86 0.29
87 0.27
88 0.22
89 0.22
90 0.26
91 0.25
92 0.29
93 0.3
94 0.31
95 0.4
96 0.46
97 0.48
98 0.5
99 0.51
100 0.47
101 0.48
102 0.51
103 0.41
104 0.36
105 0.35
106 0.29
107 0.3
108 0.33
109 0.3
110 0.31
111 0.31
112 0.36
113 0.38
114 0.45
115 0.44
116 0.4
117 0.38
118 0.35
119 0.33
120 0.28
121 0.26
122 0.22
123 0.19
124 0.23
125 0.22
126 0.19
127 0.2
128 0.21
129 0.24
130 0.23
131 0.23
132 0.19
133 0.25
134 0.26
135 0.24
136 0.22
137 0.17
138 0.15
139 0.13
140 0.12
141 0.06
142 0.05
143 0.05
144 0.05
145 0.07
146 0.07
147 0.07
148 0.07
149 0.08
150 0.11
151 0.15
152 0.16
153 0.14
154 0.15
155 0.17
156 0.18
157 0.17
158 0.14
159 0.1
160 0.09
161 0.08
162 0.09
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.1
171 0.09
172 0.1
173 0.11
174 0.12
175 0.12
176 0.13
177 0.14
178 0.13
179 0.23
180 0.28
181 0.36
182 0.46
183 0.54
184 0.63
185 0.7
186 0.79
187 0.8
188 0.85
189 0.87
190 0.88
191 0.87
192 0.83
193 0.75
194 0.7
195 0.61
196 0.51
197 0.4
198 0.3
199 0.23
200 0.17
201 0.15
202 0.11
203 0.1
204 0.11
205 0.11
206 0.1
207 0.11
208 0.14
209 0.14
210 0.15
211 0.16
212 0.2
213 0.3
214 0.32
215 0.31
216 0.35
217 0.42
218 0.46
219 0.55
220 0.58
221 0.55
222 0.62
223 0.69
224 0.71
225 0.69
226 0.68
227 0.63
228 0.63
229 0.65
230 0.58
231 0.52
232 0.51
233 0.5
234 0.49
235 0.49
236 0.44
237 0.4
238 0.46
239 0.5
240 0.51
241 0.53
242 0.52
243 0.5
244 0.54
245 0.52
246 0.51
247 0.51
248 0.52
249 0.53
250 0.54
251 0.55
252 0.52
253 0.53
254 0.52
255 0.5