Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U9X1

Protein Details
Accession A0A316U9X1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
547-566GTPTGPKGGKKNNANNKAKSHydrophilic
NLS Segment(s)
PositionSequence
553-557KGGKK
Subcellular Location(s) mito 22.5, cyto_mito 13.333, cyto 3, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011387  TIF2A  
IPR013979  TIF_beta_prop-like  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08662  eIF2A  
Amino Acid Sequences MASQSSSSATTQWAYRSQKSIGLLTGPPSYAPVSGFDREEADSSNQTRVFKYSPDGRWVAMGMENHLLLLSTSDPTASVRTHTIPLPRVVDLAFSPRGGYLSTWQRPFKDEEGNNVPNLRLWRTSDGAEVGAWERKSQEGCHPQLNEEETYLVRQVSTELQVFEPNAVQAKGVVGRLRLEGMTSFELGAGSKPVVAVFCGEKKGAPASVRVFSLASLIPSPENPPAPVSQKTFFKADKIQMKWNKAGTSLLFMTSTDVDKTGKSYYGETNLYMISSRGDFDCRVALDKEGPIHDFEWSSNGREFIVVYGYMPSKATLFSFRVNVIAELCSAARNTVTFNPQGRLFCLAGFGNLNGMVDVWDRQNLGKGKLFTFDASNSSVLEWSPCGEFILTATLSPRLRVENGIKIWHCTGQLIHVDFIDEMYQAGWRPGWSTATAQGARDPPPFPAELPASPAPSAAAKEWLDKAAAKPQRPAGAYRPPGARGAAASTAYSREEDSLGSSSPSRPGAGTNGHGAYVPGANRGKRQVPGAPRPKENQSNGSAPGPGTPTGPKGGKKNNANNKAKSNTGTPTPTAPASPGPGAQVSLGSEAVDASSSSSSAPPATSGAAEVGGNSQAVALDKKLRNLTKKLKAIEDLKARRDAGEKLEQTQMLKIANEGELRRELQALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.41
4 0.41
5 0.44
6 0.44
7 0.43
8 0.36
9 0.34
10 0.31
11 0.29
12 0.3
13 0.25
14 0.22
15 0.21
16 0.2
17 0.17
18 0.16
19 0.17
20 0.19
21 0.22
22 0.23
23 0.22
24 0.23
25 0.24
26 0.24
27 0.23
28 0.22
29 0.25
30 0.26
31 0.31
32 0.32
33 0.32
34 0.32
35 0.33
36 0.31
37 0.28
38 0.34
39 0.37
40 0.39
41 0.44
42 0.44
43 0.4
44 0.4
45 0.38
46 0.32
47 0.27
48 0.23
49 0.18
50 0.19
51 0.18
52 0.16
53 0.15
54 0.14
55 0.09
56 0.1
57 0.09
58 0.07
59 0.08
60 0.08
61 0.08
62 0.1
63 0.12
64 0.12
65 0.13
66 0.16
67 0.18
68 0.21
69 0.24
70 0.3
71 0.31
72 0.35
73 0.36
74 0.33
75 0.31
76 0.29
77 0.27
78 0.22
79 0.23
80 0.2
81 0.17
82 0.17
83 0.16
84 0.16
85 0.15
86 0.15
87 0.17
88 0.26
89 0.32
90 0.38
91 0.41
92 0.42
93 0.44
94 0.48
95 0.46
96 0.46
97 0.41
98 0.43
99 0.49
100 0.5
101 0.48
102 0.44
103 0.39
104 0.32
105 0.34
106 0.28
107 0.22
108 0.24
109 0.27
110 0.28
111 0.29
112 0.28
113 0.26
114 0.24
115 0.2
116 0.18
117 0.15
118 0.18
119 0.17
120 0.15
121 0.15
122 0.17
123 0.19
124 0.2
125 0.28
126 0.33
127 0.36
128 0.42
129 0.43
130 0.41
131 0.44
132 0.44
133 0.35
134 0.27
135 0.24
136 0.18
137 0.19
138 0.18
139 0.14
140 0.1
141 0.09
142 0.1
143 0.12
144 0.14
145 0.14
146 0.15
147 0.15
148 0.17
149 0.17
150 0.17
151 0.14
152 0.12
153 0.13
154 0.11
155 0.1
156 0.09
157 0.11
158 0.12
159 0.13
160 0.14
161 0.13
162 0.14
163 0.15
164 0.16
165 0.14
166 0.13
167 0.11
168 0.13
169 0.14
170 0.13
171 0.12
172 0.11
173 0.11
174 0.1
175 0.1
176 0.08
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.08
184 0.09
185 0.12
186 0.13
187 0.13
188 0.13
189 0.15
190 0.16
191 0.18
192 0.16
193 0.18
194 0.2
195 0.22
196 0.22
197 0.22
198 0.2
199 0.17
200 0.18
201 0.13
202 0.11
203 0.09
204 0.09
205 0.09
206 0.09
207 0.12
208 0.13
209 0.13
210 0.13
211 0.14
212 0.17
213 0.2
214 0.24
215 0.25
216 0.26
217 0.29
218 0.31
219 0.34
220 0.31
221 0.31
222 0.32
223 0.36
224 0.4
225 0.4
226 0.47
227 0.49
228 0.53
229 0.54
230 0.52
231 0.45
232 0.38
233 0.37
234 0.27
235 0.25
236 0.21
237 0.17
238 0.14
239 0.13
240 0.14
241 0.13
242 0.13
243 0.09
244 0.09
245 0.09
246 0.09
247 0.11
248 0.11
249 0.12
250 0.12
251 0.14
252 0.15
253 0.2
254 0.2
255 0.19
256 0.19
257 0.16
258 0.15
259 0.13
260 0.11
261 0.07
262 0.07
263 0.07
264 0.06
265 0.08
266 0.08
267 0.09
268 0.11
269 0.1
270 0.12
271 0.12
272 0.13
273 0.13
274 0.14
275 0.14
276 0.13
277 0.14
278 0.13
279 0.12
280 0.12
281 0.11
282 0.1
283 0.12
284 0.12
285 0.14
286 0.13
287 0.13
288 0.12
289 0.12
290 0.12
291 0.08
292 0.09
293 0.06
294 0.06
295 0.07
296 0.08
297 0.08
298 0.08
299 0.08
300 0.07
301 0.07
302 0.08
303 0.09
304 0.11
305 0.12
306 0.13
307 0.13
308 0.14
309 0.14
310 0.14
311 0.11
312 0.09
313 0.08
314 0.07
315 0.07
316 0.06
317 0.06
318 0.06
319 0.05
320 0.05
321 0.07
322 0.09
323 0.11
324 0.14
325 0.15
326 0.17
327 0.19
328 0.19
329 0.18
330 0.19
331 0.17
332 0.14
333 0.15
334 0.13
335 0.11
336 0.11
337 0.1
338 0.07
339 0.07
340 0.07
341 0.05
342 0.05
343 0.04
344 0.04
345 0.05
346 0.05
347 0.06
348 0.07
349 0.07
350 0.13
351 0.14
352 0.17
353 0.2
354 0.21
355 0.2
356 0.22
357 0.23
358 0.17
359 0.17
360 0.15
361 0.13
362 0.14
363 0.13
364 0.12
365 0.11
366 0.11
367 0.09
368 0.09
369 0.07
370 0.06
371 0.06
372 0.06
373 0.06
374 0.06
375 0.06
376 0.05
377 0.08
378 0.07
379 0.07
380 0.08
381 0.12
382 0.12
383 0.12
384 0.13
385 0.12
386 0.13
387 0.17
388 0.19
389 0.22
390 0.24
391 0.28
392 0.28
393 0.28
394 0.28
395 0.26
396 0.23
397 0.17
398 0.15
399 0.14
400 0.18
401 0.17
402 0.16
403 0.14
404 0.15
405 0.14
406 0.14
407 0.1
408 0.06
409 0.05
410 0.05
411 0.06
412 0.05
413 0.06
414 0.06
415 0.06
416 0.07
417 0.08
418 0.09
419 0.1
420 0.11
421 0.14
422 0.2
423 0.21
424 0.19
425 0.22
426 0.23
427 0.25
428 0.26
429 0.24
430 0.19
431 0.2
432 0.21
433 0.17
434 0.19
435 0.19
436 0.16
437 0.21
438 0.22
439 0.21
440 0.21
441 0.2
442 0.17
443 0.15
444 0.16
445 0.11
446 0.14
447 0.13
448 0.16
449 0.17
450 0.17
451 0.17
452 0.17
453 0.18
454 0.22
455 0.27
456 0.27
457 0.3
458 0.33
459 0.38
460 0.38
461 0.4
462 0.37
463 0.42
464 0.43
465 0.44
466 0.43
467 0.39
468 0.39
469 0.36
470 0.3
471 0.2
472 0.2
473 0.17
474 0.14
475 0.13
476 0.12
477 0.13
478 0.14
479 0.13
480 0.11
481 0.1
482 0.1
483 0.1
484 0.12
485 0.12
486 0.12
487 0.12
488 0.13
489 0.13
490 0.15
491 0.16
492 0.14
493 0.13
494 0.14
495 0.17
496 0.2
497 0.2
498 0.22
499 0.21
500 0.21
501 0.2
502 0.19
503 0.16
504 0.15
505 0.14
506 0.16
507 0.19
508 0.2
509 0.24
510 0.29
511 0.32
512 0.31
513 0.35
514 0.36
515 0.42
516 0.51
517 0.58
518 0.59
519 0.6
520 0.62
521 0.66
522 0.68
523 0.63
524 0.59
525 0.54
526 0.52
527 0.5
528 0.47
529 0.4
530 0.31
531 0.28
532 0.25
533 0.2
534 0.18
535 0.17
536 0.18
537 0.22
538 0.26
539 0.27
540 0.33
541 0.42
542 0.49
543 0.57
544 0.65
545 0.71
546 0.77
547 0.82
548 0.8
549 0.79
550 0.74
551 0.68
552 0.6
553 0.54
554 0.47
555 0.45
556 0.42
557 0.35
558 0.35
559 0.34
560 0.32
561 0.28
562 0.26
563 0.22
564 0.22
565 0.22
566 0.19
567 0.18
568 0.18
569 0.18
570 0.16
571 0.15
572 0.12
573 0.12
574 0.12
575 0.1
576 0.09
577 0.08
578 0.08
579 0.08
580 0.06
581 0.07
582 0.07
583 0.07
584 0.08
585 0.09
586 0.1
587 0.1
588 0.1
589 0.1
590 0.11
591 0.12
592 0.11
593 0.11
594 0.11
595 0.11
596 0.1
597 0.1
598 0.1
599 0.09
600 0.09
601 0.08
602 0.07
603 0.07
604 0.09
605 0.1
606 0.11
607 0.2
608 0.23
609 0.29
610 0.37
611 0.44
612 0.5
613 0.58
614 0.66
615 0.67
616 0.73
617 0.72
618 0.69
619 0.7
620 0.67
621 0.66
622 0.67
623 0.64
624 0.61
625 0.62
626 0.57
627 0.52
628 0.51
629 0.46
630 0.42
631 0.44
632 0.41
633 0.39
634 0.44
635 0.43
636 0.41
637 0.4
638 0.36
639 0.28
640 0.26
641 0.24
642 0.21
643 0.22
644 0.26
645 0.24
646 0.25
647 0.27
648 0.28
649 0.29