Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U7T9

Protein Details
Accession A0A316U7T9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
77-100PDQRRAPTRIRKACERCSRMKIRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences EEDRTPCPVCERSFSRPEHMYRHLLIHQGQEDGMQQQHVCSVCNKEYSRKDALLRHQQTHGPEVADALAASSRLASPDQRRAPTRIRKACERCSRMKIRCDGQRPCQKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.54
4 0.55
5 0.54
6 0.53
7 0.5
8 0.44
9 0.45
10 0.4
11 0.38
12 0.36
13 0.33
14 0.29
15 0.25
16 0.23
17 0.19
18 0.18
19 0.15
20 0.14
21 0.1
22 0.09
23 0.08
24 0.11
25 0.11
26 0.11
27 0.11
28 0.15
29 0.16
30 0.23
31 0.24
32 0.29
33 0.32
34 0.36
35 0.38
36 0.36
37 0.38
38 0.37
39 0.43
40 0.46
41 0.46
42 0.43
43 0.41
44 0.41
45 0.39
46 0.36
47 0.29
48 0.19
49 0.16
50 0.14
51 0.12
52 0.1
53 0.08
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.11
63 0.16
64 0.26
65 0.32
66 0.36
67 0.4
68 0.44
69 0.53
70 0.59
71 0.65
72 0.64
73 0.64
74 0.7
75 0.75
76 0.8
77 0.81
78 0.77
79 0.75
80 0.76
81 0.8
82 0.77
83 0.77
84 0.75
85 0.73
86 0.76
87 0.77
88 0.76
89 0.76