Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U3V9

Protein Details
Accession A0A316U3V9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-90TPSRRPFPRVRRTSWRRHHNSRPNTRRPRQPGMRQGLISHydrophilic
NLS Segment(s)
PositionSequence
37-81PRRRNVPRNAGRPTATPSRRPFPRVRRTSWRRHHNSRPNTRRPRQ
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MQRQPPPRRCWLPLNGHCWSRATRKQGFLTFEFEHPPRRRNVPRNAGRPTATPSRRPFPRVRRTSWRRHHNSRPNTRRPRQPGMRQGLISVYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.66
3 0.6
4 0.55
5 0.5
6 0.45
7 0.42
8 0.42
9 0.43
10 0.44
11 0.49
12 0.53
13 0.56
14 0.56
15 0.49
16 0.49
17 0.43
18 0.38
19 0.35
20 0.31
21 0.35
22 0.33
23 0.34
24 0.31
25 0.37
26 0.45
27 0.5
28 0.59
29 0.6
30 0.66
31 0.71
32 0.72
33 0.66
34 0.59
35 0.51
36 0.46
37 0.45
38 0.39
39 0.39
40 0.39
41 0.43
42 0.46
43 0.5
44 0.54
45 0.55
46 0.63
47 0.63
48 0.66
49 0.69
50 0.74
51 0.79
52 0.81
53 0.81
54 0.8
55 0.82
56 0.86
57 0.85
58 0.88
59 0.89
60 0.89
61 0.89
62 0.91
63 0.9
64 0.89
65 0.87
66 0.87
67 0.86
68 0.86
69 0.85
70 0.83
71 0.82
72 0.72
73 0.65