Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UCC7

Protein Details
Accession A0A316UCC7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-74TSRLAPRAGRDWRRKMKMKLKNCVACGHydrophilic
NLS Segment(s)
PositionSequence
60-63RRKM
Subcellular Location(s) extr 21, plas 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLPYLAFILVLLSATIVAATSIADDVVHRSTTHKDPNSAGTVAFASTSRLAPRAGRDWRRKMKMKLKNCVACGAPPDSGSTSSGGGVLPYRSGTGGRSPLMSHGASTSRSRHASPDRAGTTRQGSPSSSNTVASPAAGHSHSGPADSITVRPDMRLPHRVDLRLIEGEYAVPFVVCPVNEQLGGSVSEIATPGLLLVRGTITSPEVFPYERVASHHHYTCAHDALAAPYRAAGAMRPQSLGNFEKSSDATTYKHDHRVAIHLFGRAIDEIVRHLGDCGEESAGQLPTQAQLPPSAIAPSKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.08
14 0.1
15 0.11
16 0.11
17 0.14
18 0.19
19 0.27
20 0.36
21 0.38
22 0.39
23 0.41
24 0.46
25 0.48
26 0.44
27 0.36
28 0.28
29 0.24
30 0.2
31 0.18
32 0.13
33 0.11
34 0.11
35 0.13
36 0.13
37 0.14
38 0.15
39 0.17
40 0.22
41 0.28
42 0.37
43 0.45
44 0.53
45 0.63
46 0.72
47 0.79
48 0.82
49 0.84
50 0.85
51 0.85
52 0.85
53 0.85
54 0.84
55 0.82
56 0.74
57 0.68
58 0.59
59 0.5
60 0.44
61 0.37
62 0.27
63 0.21
64 0.22
65 0.19
66 0.19
67 0.18
68 0.15
69 0.13
70 0.12
71 0.12
72 0.1
73 0.09
74 0.09
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.09
82 0.12
83 0.15
84 0.15
85 0.16
86 0.16
87 0.17
88 0.2
89 0.18
90 0.14
91 0.13
92 0.14
93 0.15
94 0.18
95 0.19
96 0.2
97 0.22
98 0.23
99 0.27
100 0.32
101 0.37
102 0.37
103 0.42
104 0.4
105 0.4
106 0.41
107 0.37
108 0.34
109 0.3
110 0.29
111 0.22
112 0.21
113 0.22
114 0.24
115 0.26
116 0.22
117 0.2
118 0.18
119 0.19
120 0.17
121 0.14
122 0.12
123 0.07
124 0.08
125 0.08
126 0.08
127 0.07
128 0.09
129 0.09
130 0.09
131 0.08
132 0.07
133 0.08
134 0.08
135 0.08
136 0.07
137 0.09
138 0.09
139 0.09
140 0.11
141 0.13
142 0.17
143 0.24
144 0.26
145 0.29
146 0.33
147 0.33
148 0.32
149 0.3
150 0.29
151 0.22
152 0.2
153 0.14
154 0.11
155 0.11
156 0.1
157 0.09
158 0.05
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.08
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.1
172 0.08
173 0.07
174 0.06
175 0.06
176 0.07
177 0.06
178 0.05
179 0.04
180 0.04
181 0.03
182 0.04
183 0.03
184 0.03
185 0.04
186 0.04
187 0.05
188 0.05
189 0.06
190 0.07
191 0.08
192 0.08
193 0.1
194 0.1
195 0.1
196 0.14
197 0.14
198 0.14
199 0.16
200 0.2
201 0.24
202 0.29
203 0.31
204 0.29
205 0.29
206 0.32
207 0.33
208 0.3
209 0.24
210 0.2
211 0.18
212 0.19
213 0.24
214 0.2
215 0.17
216 0.15
217 0.15
218 0.15
219 0.14
220 0.11
221 0.13
222 0.18
223 0.19
224 0.2
225 0.2
226 0.21
227 0.26
228 0.27
229 0.24
230 0.2
231 0.2
232 0.22
233 0.22
234 0.23
235 0.21
236 0.21
237 0.18
238 0.22
239 0.28
240 0.31
241 0.38
242 0.37
243 0.37
244 0.37
245 0.44
246 0.42
247 0.42
248 0.39
249 0.33
250 0.32
251 0.3
252 0.3
253 0.22
254 0.2
255 0.14
256 0.12
257 0.11
258 0.14
259 0.14
260 0.12
261 0.12
262 0.12
263 0.12
264 0.13
265 0.12
266 0.11
267 0.11
268 0.12
269 0.15
270 0.15
271 0.14
272 0.13
273 0.12
274 0.12
275 0.14
276 0.14
277 0.12
278 0.13
279 0.16
280 0.16
281 0.16
282 0.19