FuNGI

A0A316U4N3

Protein Details

Accession

A0A316U4N3

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
293-314	AGEKKDKVSKKKEKEPGKPPVL	Basic

NLS Segment(s)

Position	Sequence
188-226	KGSGKASRAPASGRKGSVGGVGNGAGAPSKKAGGGAKGA
294-322	GEKKDKVSKKKEKEPGKPPVLKSHLKPPK
410-427	RKAGKSRKGNLKDPNAPK

Subcellular Location(s)

cyto 13.5, cyto_nucl 11, nucl 5.5, mito 4, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR009071 HMG_box_dom IPR036910 HMG_box_dom_sf
Gene Ontology	GO:0005634 C:nucleus GO:0003677 F:DNA binding
Pfam	View protein in Pfam PF00505 HMG_box
PROSITE	View protein in PROSITE PS50118 HMG_BOX_2

Amino Acid Sequences

MQPSAFSHEQGGGAGQHGGFYGQQAGAYGTGGAPHHNAHTGVHGGYGGYAAHPSHGDQSPSMSYLQPGSGHSTHMGMYGGYSGHYPTHHANPQQQQHYSHVNAAAFGGQPGGGQSILGGNNVDYQGGVHPSSYSHMAPQHGMYYQDAGGMMHPAHAHNMMGSAGTMPGSGYSHPSAIAAPLQTPAGAKGSGKASRAPASGRKGSVGGVGNGAGAPSKKAGGGAKGAKAQAQSDAIAAAAAAGVDPNDPVALAAMGIVLDTPASGKAKSSKANTGGDRHHPYGGAAPGGLAPDAGEKKDKVSKKKEKEPGKPPVLKSHLKPPKQAPSAWQVYFTEELQKIKAEQPGARLNVAHVAKDAGQRYAALPDEKKQEFQRRSQEAKQQWEQDMLDWKSHLTPEDIKQENMFRTAQRKAGKSRKGNLKDPNAPKKPLSAYFLFLRAIRADPKMTEDVFHGEQETTKQSVLAAAKWRSLEEPEKQPFLEKAEADKVEYERLRKDYEASHGVGGDGLRDDSEEGGSAVGGTGDYGGYDEGEGGVPPSLAAGAGGDEAFKLDSHFGLGEDAVLGFSSKDEGGFGLEG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.12
3	0.11
4	0.1
5	0.11
6	0.09
7	0.1
8	0.11
9	0.1
10	0.1
11	0.1
12	0.11
13	0.11
14	0.11
15	0.1
16	0.07
17	0.1
18	0.1
19	0.11
20	0.12
21	0.13
22	0.15
23	0.17
24	0.18
25	0.15
26	0.19
27	0.2
28	0.18
29	0.17
30	0.16
31	0.13
32	0.12
33	0.12
34	0.08
35	0.06
36	0.08
37	0.07
38	0.09
39	0.09
40	0.11
41	0.16
42	0.19
43	0.2
44	0.19
45	0.23
46	0.24
47	0.24
48	0.25
49	0.19
50	0.17
51	0.17
52	0.19
53	0.16
54	0.16
55	0.22
56	0.21
57	0.22
58	0.22
59	0.21
60	0.19
61	0.19
62	0.18
63	0.1
64	0.1
65	0.1
66	0.09
67	0.08
68	0.08
69	0.08
70	0.09
71	0.1
72	0.13
73	0.16
74	0.24
75	0.29
76	0.33
77	0.41
78	0.48
79	0.56
80	0.6
81	0.6
82	0.55
83	0.54
84	0.57
85	0.5
86	0.44
87	0.4
88	0.33
89	0.29
90	0.26
91	0.23
92	0.16
93	0.14
94	0.11
95	0.07
96	0.07
97	0.07
98	0.08
99	0.06
100	0.05
101	0.05
102	0.09
103	0.09
104	0.1
105	0.09
106	0.08
107	0.11
108	0.11
109	0.11
110	0.07
111	0.08
112	0.09
113	0.12
114	0.12
115	0.09
116	0.09
117	0.1
118	0.13
119	0.15
120	0.13
121	0.14
122	0.17
123	0.18
124	0.2
125	0.2
126	0.2
127	0.18
128	0.19
129	0.16
130	0.16
131	0.14
132	0.13
133	0.13
134	0.11
135	0.1
136	0.1
137	0.09
138	0.08
139	0.09
140	0.08
141	0.1
142	0.1
143	0.1
144	0.08
145	0.09
146	0.08
147	0.07
148	0.07
149	0.06
150	0.05
151	0.05
152	0.05
153	0.04
154	0.05
155	0.06
156	0.06
157	0.09
158	0.1
159	0.1
160	0.1
161	0.11
162	0.1
163	0.1
164	0.12
165	0.09
166	0.08
167	0.09
168	0.09
169	0.08
170	0.09
171	0.09
172	0.09
173	0.09
174	0.08
175	0.1
176	0.15
177	0.18
178	0.19
179	0.21
180	0.23
181	0.25
182	0.27
183	0.27
184	0.29
185	0.32
186	0.35
187	0.33
188	0.31
189	0.28
190	0.27
191	0.28
192	0.23
193	0.17
194	0.14
195	0.13
196	0.12
197	0.11
198	0.11
199	0.07
200	0.05
201	0.05
202	0.05
203	0.06
204	0.06
205	0.08
206	0.09
207	0.1
208	0.16
209	0.19
210	0.21
211	0.23
212	0.23
213	0.23
214	0.23
215	0.21
216	0.17
217	0.15
218	0.13
219	0.1
220	0.1
221	0.08
222	0.07
223	0.06
224	0.04
225	0.03
226	0.02
227	0.02
228	0.02
229	0.02
230	0.02
231	0.02
232	0.03
233	0.03
234	0.03
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.02
241	0.02
242	0.02
243	0.02
244	0.02
245	0.02
246	0.02
247	0.02
248	0.04
249	0.05
250	0.05
251	0.06
252	0.11
253	0.15
254	0.2
255	0.22
256	0.26
257	0.3
258	0.35
259	0.36
260	0.37
261	0.37
262	0.39
263	0.41
264	0.38
265	0.33
266	0.28
267	0.26
268	0.25
269	0.22
270	0.15
271	0.09
272	0.08
273	0.08
274	0.08
275	0.07
276	0.04
277	0.03
278	0.06
279	0.06
280	0.07
281	0.08
282	0.08
283	0.11
284	0.18
285	0.23
286	0.29
287	0.39
288	0.49
289	0.56
290	0.66
291	0.72
292	0.76
293	0.8
294	0.81
295	0.8
296	0.79
297	0.77
298	0.68
299	0.68
300	0.65
301	0.59
302	0.51
303	0.52
304	0.52
305	0.48
306	0.52
307	0.49
308	0.53
309	0.53
310	0.52
311	0.44
312	0.43
313	0.47
314	0.42
315	0.37
316	0.28
317	0.27
318	0.27
319	0.24
320	0.22
321	0.18
322	0.18
323	0.17
324	0.17
325	0.17
326	0.18
327	0.21
328	0.18
329	0.18
330	0.22
331	0.27
332	0.28
333	0.27
334	0.24
335	0.21
336	0.26
337	0.24
338	0.19
339	0.14
340	0.13
341	0.15
342	0.19
343	0.2
344	0.13
345	0.13
346	0.14
347	0.14
348	0.15
349	0.15
350	0.14
351	0.14
352	0.18
353	0.25
354	0.25
355	0.28
356	0.32
357	0.41
358	0.42
359	0.48
360	0.55
361	0.55
362	0.61
363	0.64
364	0.66
365	0.63
366	0.67
367	0.65
368	0.6
369	0.53
370	0.51
371	0.45
372	0.38
373	0.4
374	0.33
375	0.28
376	0.23
377	0.23
378	0.2
379	0.21
380	0.19
381	0.13
382	0.17
383	0.2
384	0.29
385	0.31
386	0.3
387	0.31
388	0.34
389	0.32
390	0.31
391	0.28
392	0.21
393	0.25
394	0.28
395	0.32
396	0.34
397	0.38
398	0.44
399	0.53
400	0.59
401	0.62
402	0.68
403	0.73
404	0.74
405	0.77
406	0.76
407	0.76
408	0.77
409	0.78
410	0.8
411	0.75
412	0.71
413	0.64
414	0.61
415	0.57
416	0.51
417	0.46
418	0.38
419	0.35
420	0.34
421	0.35
422	0.3
423	0.26
424	0.23
425	0.2
426	0.2
427	0.19
428	0.2
429	0.19
430	0.18
431	0.23
432	0.25
433	0.23
434	0.22
435	0.2
436	0.23
437	0.23
438	0.23
439	0.19
440	0.16
441	0.16
442	0.18
443	0.2
444	0.16
445	0.15
446	0.15
447	0.13
448	0.18
449	0.19
450	0.21
451	0.25
452	0.26
453	0.28
454	0.29
455	0.3
456	0.26
457	0.3
458	0.32
459	0.3
460	0.38
461	0.4
462	0.42
463	0.42
464	0.43
465	0.4
466	0.39
467	0.37
468	0.29
469	0.29
470	0.34
471	0.35
472	0.33
473	0.35
474	0.31
475	0.33
476	0.35
477	0.34
478	0.32
479	0.35
480	0.37
481	0.34
482	0.36
483	0.32
484	0.37
485	0.38
486	0.34
487	0.31
488	0.28
489	0.27
490	0.25
491	0.21
492	0.15
493	0.11
494	0.09
495	0.08
496	0.08
497	0.09
498	0.08
499	0.09
500	0.08
501	0.07
502	0.07
503	0.07
504	0.06
505	0.06
506	0.05
507	0.04
508	0.04
509	0.04
510	0.04
511	0.04
512	0.05
513	0.05
514	0.05
515	0.05
516	0.05
517	0.06
518	0.06
519	0.06
520	0.06
521	0.07
522	0.06
523	0.06
524	0.06
525	0.06
526	0.05
527	0.05
528	0.04
529	0.05
530	0.06
531	0.06
532	0.06
533	0.05
534	0.06
535	0.07
536	0.07
537	0.08
538	0.08
539	0.09
540	0.11
541	0.11
542	0.11
543	0.12
544	0.12
545	0.1
546	0.1
547	0.09
548	0.07
549	0.07
550	0.07
551	0.06
552	0.06
553	0.08
554	0.07
555	0.08
556	0.08
557	0.08

A0A316U4N3

3D AlphaFold-predicted Structure Viewer