Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U3I3

Protein Details
Accession A0A316U3I3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQSRKAHRNGIKKPKTNKYPSHydrophilic
NLS Segment(s)
PositionSequence
14-29RKAHRNGIKKPKTNKY
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSRKAHRNGIKKPKTNKYPSLKGVDPKFVRNQRYAKHGTEKALRESRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.74
5 0.75
6 0.76
7 0.82
8 0.81
9 0.79
10 0.81
11 0.81
12 0.82
13 0.79
14 0.78
15 0.75
16 0.73
17 0.69
18 0.67
19 0.59
20 0.56
21 0.52
22 0.51
23 0.45
24 0.41
25 0.46
26 0.47
27 0.48
28 0.49
29 0.53
30 0.48
31 0.55
32 0.56
33 0.53
34 0.55
35 0.55
36 0.55
37 0.56
38 0.57
39 0.58