Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UJN5

Protein Details
Accession A0A316UJN5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-69FLCRRCSWPLRQQRLQRQQHRCPPCSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MPCYPASPPIPFAQPFSLYSTPPRSPLRCSRRFPPLPHPARVFLCRRCSWPLRQQRLQRQQHRCPPCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.32
4 0.3
5 0.26
6 0.3
7 0.33
8 0.3
9 0.33
10 0.37
11 0.32
12 0.37
13 0.47
14 0.52
15 0.54
16 0.58
17 0.57
18 0.62
19 0.65
20 0.63
21 0.62
22 0.63
23 0.59
24 0.59
25 0.57
26 0.5
27 0.48
28 0.49
29 0.45
30 0.4
31 0.43
32 0.4
33 0.42
34 0.44
35 0.46
36 0.49
37 0.53
38 0.58
39 0.61
40 0.68
41 0.74
42 0.78
43 0.84
44 0.87
45 0.87
46 0.86
47 0.87
48 0.89
49 0.89