Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U2U6

Protein Details
Accession A0A316U2U6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-26FLNAVPKKKVSHSRKRMRAANKGLKDHydrophilic
NLS Segment(s)
PositionSequence
7-22KKKVSHSRKRMRAANK
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences FLNAVPKKKVSHSRKRMRAANKGLKDRVDFVHCQACGNPKLAHHICASCFGDIARRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.84
5 0.83
6 0.83
7 0.82
8 0.78
9 0.76
10 0.7
11 0.64
12 0.56
13 0.49
14 0.41
15 0.34
16 0.27
17 0.22
18 0.25
19 0.23
20 0.22
21 0.21
22 0.24
23 0.21
24 0.24
25 0.23
26 0.18
27 0.28
28 0.29
29 0.3
30 0.27
31 0.28
32 0.26
33 0.32
34 0.33
35 0.23
36 0.23
37 0.2
38 0.25