Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CKC3

Protein Details
Accession A1CKC3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
127-155VLRVAKLRRKKKEPVSKDRQRKKNPQISEBasic
277-308NGIVYAYPKKVRKRGKGSRRETNLRRKRTESEHydrophilic
NLS Segment(s)
PositionSequence
131-150AKLRRKKKEPVSKDRQRKKN
285-304KKVRKRGKGSRRETNLRRKR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
KEGG act:ACLA_038070  -  
Amino Acid Sequences MAIRVFRLVLTGLLSSIAGATYMVPYRTLGIEEESASLLPDGTAGIDPVQKRYSRDLNYGAIIQRAGNSQNDVWSHQVRTRPPITRISSRRLQPLSALQGIEEEVQVDDDYIAEDTRPQGSADDAPVLRVAKLRRKKKEPVSKDRQRKKNPQISEDPSKADLGDDMSFRKTVWRPDAPEFVPTAHRRQLVRQVNEGRDDELNSPRAIGKEHILASSRDQDIIPSRDTDAPTAMKEDLKLSITNENRGPNPNTSKTDSGRAIERDHNNSASVLKQALNGIVYAYPKKVRKRGKGSRRETNLRRKRTESEPAGIGLNSHLNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.05
6 0.05
7 0.05
8 0.07
9 0.1
10 0.1
11 0.11
12 0.11
13 0.13
14 0.14
15 0.15
16 0.13
17 0.14
18 0.15
19 0.16
20 0.16
21 0.15
22 0.14
23 0.14
24 0.12
25 0.09
26 0.07
27 0.06
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.11
34 0.12
35 0.16
36 0.21
37 0.22
38 0.25
39 0.32
40 0.39
41 0.4
42 0.45
43 0.46
44 0.44
45 0.44
46 0.44
47 0.38
48 0.3
49 0.26
50 0.2
51 0.17
52 0.16
53 0.16
54 0.14
55 0.16
56 0.15
57 0.19
58 0.2
59 0.2
60 0.23
61 0.24
62 0.25
63 0.26
64 0.31
65 0.3
66 0.36
67 0.4
68 0.42
69 0.43
70 0.49
71 0.52
72 0.56
73 0.58
74 0.58
75 0.58
76 0.56
77 0.61
78 0.53
79 0.48
80 0.41
81 0.42
82 0.4
83 0.35
84 0.32
85 0.23
86 0.22
87 0.22
88 0.19
89 0.13
90 0.08
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.04
101 0.05
102 0.06
103 0.07
104 0.08
105 0.07
106 0.07
107 0.09
108 0.1
109 0.1
110 0.13
111 0.12
112 0.12
113 0.13
114 0.13
115 0.12
116 0.14
117 0.17
118 0.23
119 0.32
120 0.41
121 0.48
122 0.55
123 0.64
124 0.71
125 0.79
126 0.79
127 0.81
128 0.83
129 0.84
130 0.88
131 0.89
132 0.88
133 0.87
134 0.88
135 0.87
136 0.85
137 0.79
138 0.74
139 0.72
140 0.69
141 0.67
142 0.57
143 0.49
144 0.41
145 0.37
146 0.3
147 0.22
148 0.16
149 0.1
150 0.1
151 0.09
152 0.09
153 0.09
154 0.1
155 0.09
156 0.14
157 0.14
158 0.18
159 0.24
160 0.28
161 0.31
162 0.35
163 0.41
164 0.36
165 0.36
166 0.31
167 0.26
168 0.28
169 0.26
170 0.26
171 0.25
172 0.28
173 0.27
174 0.31
175 0.4
176 0.42
177 0.43
178 0.47
179 0.49
180 0.47
181 0.5
182 0.47
183 0.39
184 0.3
185 0.29
186 0.24
187 0.21
188 0.21
189 0.17
190 0.17
191 0.16
192 0.16
193 0.16
194 0.14
195 0.13
196 0.16
197 0.17
198 0.17
199 0.18
200 0.18
201 0.19
202 0.24
203 0.22
204 0.19
205 0.18
206 0.18
207 0.22
208 0.25
209 0.23
210 0.18
211 0.2
212 0.23
213 0.24
214 0.23
215 0.2
216 0.19
217 0.18
218 0.2
219 0.18
220 0.15
221 0.15
222 0.15
223 0.15
224 0.15
225 0.15
226 0.15
227 0.22
228 0.23
229 0.27
230 0.29
231 0.3
232 0.31
233 0.35
234 0.37
235 0.36
236 0.42
237 0.44
238 0.45
239 0.47
240 0.5
241 0.48
242 0.51
243 0.47
244 0.41
245 0.41
246 0.39
247 0.38
248 0.41
249 0.44
250 0.43
251 0.44
252 0.43
253 0.38
254 0.36
255 0.33
256 0.26
257 0.22
258 0.17
259 0.14
260 0.15
261 0.15
262 0.16
263 0.15
264 0.13
265 0.12
266 0.13
267 0.15
268 0.15
269 0.18
270 0.23
271 0.3
272 0.39
273 0.47
274 0.55
275 0.63
276 0.73
277 0.8
278 0.84
279 0.89
280 0.89
281 0.9
282 0.9
283 0.9
284 0.89
285 0.89
286 0.88
287 0.87
288 0.85
289 0.81
290 0.77
291 0.75
292 0.76
293 0.71
294 0.66
295 0.59
296 0.53
297 0.49
298 0.42
299 0.34
300 0.26
301 0.24