Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UEB4

Protein Details
Accession A0A316UEB4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRRRRRSSRRRNGRTPGLQPPTBasic
NLS Segment(s)
PositionSequence
2-14RRRRRSSRRRNGR
Subcellular Location(s) plas 10, mito 7, nucl 5, E.R. 2, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRRRRRSSRRRNGRTPGLQPPTHTSHFTEEMHTTFGSGVSIHDAATCKSVSHRPRIPVMGHTSPTSTRLQRHAGRGVLLLLVLILIGIVDCAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.83
4 0.79
5 0.7
6 0.63
7 0.6
8 0.55
9 0.49
10 0.44
11 0.36
12 0.33
13 0.36
14 0.34
15 0.31
16 0.26
17 0.24
18 0.24
19 0.21
20 0.17
21 0.12
22 0.12
23 0.09
24 0.07
25 0.06
26 0.07
27 0.07
28 0.06
29 0.07
30 0.08
31 0.08
32 0.1
33 0.09
34 0.07
35 0.09
36 0.16
37 0.19
38 0.26
39 0.3
40 0.31
41 0.35
42 0.38
43 0.38
44 0.36
45 0.39
46 0.35
47 0.32
48 0.3
49 0.29
50 0.26
51 0.28
52 0.27
53 0.23
54 0.23
55 0.27
56 0.34
57 0.37
58 0.42
59 0.45
60 0.42
61 0.4
62 0.37
63 0.33
64 0.25
65 0.2
66 0.14
67 0.08
68 0.06
69 0.04
70 0.03
71 0.02
72 0.02
73 0.02
74 0.02