Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UAZ1

Protein Details
Accession A0A316UAZ1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-35ILASASKTSKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
12-28ASKTSKKKKWSKGKVKD
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKAAILASASKTSKKKKWSKGKVKDKAQNMVVLDKPTYDRILKEVPTYKMISQSVLIDRMKINGSLARVAIQHLVREGQIKKVIHHHGQLVYTRVASASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.49
4 0.55
5 0.61
6 0.67
7 0.77
8 0.82
9 0.86
10 0.89
11 0.93
12 0.93
13 0.93
14 0.9
15 0.85
16 0.8
17 0.71
18 0.64
19 0.54
20 0.48
21 0.39
22 0.33
23 0.27
24 0.2
25 0.19
26 0.17
27 0.18
28 0.15
29 0.13
30 0.15
31 0.19
32 0.19
33 0.21
34 0.25
35 0.24
36 0.26
37 0.27
38 0.24
39 0.25
40 0.25
41 0.21
42 0.16
43 0.17
44 0.15
45 0.18
46 0.17
47 0.14
48 0.14
49 0.15
50 0.15
51 0.13
52 0.13
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.11
59 0.12
60 0.16
61 0.14
62 0.13
63 0.13
64 0.14
65 0.13
66 0.19
67 0.19
68 0.2
69 0.26
70 0.27
71 0.28
72 0.36
73 0.42
74 0.42
75 0.44
76 0.43
77 0.4
78 0.43
79 0.44
80 0.39
81 0.33
82 0.28
83 0.25