Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C8U8

Protein Details
Accession A1C8U8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
226-250IIRRLQLPRNRRKCRQSHPNSTMPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011022  Arrestin_C-like  
KEGG act:ACLA_044550  -  
Pfam View protein in Pfam  
PF02752  Arrestin_C  
Amino Acid Sequences MSSTQVHIIPVLTSQLIIHFSWDPISHDSAAGHRKICWKELPIVHHIWSFLGQTRETMPAVLPPDNYEFSFTFPVSNRLPESLEGLDDSSIRYTLRAEIHAGNGETIKITKRLTVHRRYDSLLIPEPKVLMLGIVIENFWSGKVVYTVSMPSQAFPFGSEVPLNFQFIPLRKGLELESINCQLVEIEERKCPLQAIRSRDILTDNYTAAGWGDVIPSSDGADWYHIIRRLQLPRNRRKCRQSHPNSTMPIRHLIRVDIRIANRDGHVSLIRLTLPIFIHFSPLSSATGDNMSETPAFPSMSAPPDVFLPHYKDHCQDKFPGEALSVPETREKEKEPPSYFELTDLSTIPSYSATLHFRSHDFVRLLEEEDVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.14
4 0.13
5 0.15
6 0.14
7 0.15
8 0.17
9 0.18
10 0.2
11 0.2
12 0.24
13 0.22
14 0.21
15 0.22
16 0.26
17 0.31
18 0.31
19 0.29
20 0.29
21 0.36
22 0.39
23 0.43
24 0.42
25 0.4
26 0.45
27 0.5
28 0.52
29 0.49
30 0.5
31 0.47
32 0.42
33 0.39
34 0.31
35 0.27
36 0.23
37 0.22
38 0.21
39 0.19
40 0.19
41 0.21
42 0.23
43 0.21
44 0.2
45 0.16
46 0.17
47 0.2
48 0.21
49 0.19
50 0.19
51 0.23
52 0.24
53 0.24
54 0.24
55 0.2
56 0.22
57 0.24
58 0.21
59 0.21
60 0.2
61 0.25
62 0.23
63 0.26
64 0.24
65 0.23
66 0.24
67 0.21
68 0.24
69 0.19
70 0.18
71 0.15
72 0.14
73 0.13
74 0.11
75 0.12
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.12
82 0.15
83 0.15
84 0.18
85 0.19
86 0.21
87 0.23
88 0.22
89 0.18
90 0.16
91 0.15
92 0.12
93 0.12
94 0.11
95 0.12
96 0.12
97 0.14
98 0.19
99 0.28
100 0.37
101 0.46
102 0.53
103 0.56
104 0.58
105 0.57
106 0.57
107 0.5
108 0.46
109 0.43
110 0.37
111 0.32
112 0.3
113 0.28
114 0.24
115 0.21
116 0.15
117 0.08
118 0.05
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.05
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.12
137 0.12
138 0.12
139 0.12
140 0.12
141 0.11
142 0.11
143 0.12
144 0.08
145 0.1
146 0.09
147 0.09
148 0.13
149 0.13
150 0.14
151 0.12
152 0.12
153 0.13
154 0.14
155 0.17
156 0.13
157 0.14
158 0.12
159 0.13
160 0.13
161 0.16
162 0.16
163 0.15
164 0.17
165 0.17
166 0.17
167 0.16
168 0.15
169 0.1
170 0.09
171 0.11
172 0.1
173 0.1
174 0.11
175 0.12
176 0.13
177 0.13
178 0.13
179 0.12
180 0.18
181 0.22
182 0.27
183 0.3
184 0.33
185 0.33
186 0.33
187 0.34
188 0.27
189 0.25
190 0.19
191 0.16
192 0.14
193 0.13
194 0.12
195 0.1
196 0.09
197 0.05
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.06
208 0.07
209 0.07
210 0.08
211 0.11
212 0.13
213 0.13
214 0.16
215 0.22
216 0.29
217 0.37
218 0.42
219 0.49
220 0.58
221 0.69
222 0.75
223 0.77
224 0.78
225 0.79
226 0.83
227 0.84
228 0.84
229 0.84
230 0.82
231 0.81
232 0.75
233 0.69
234 0.62
235 0.53
236 0.51
237 0.41
238 0.37
239 0.31
240 0.29
241 0.3
242 0.29
243 0.3
244 0.27
245 0.27
246 0.28
247 0.29
248 0.28
249 0.24
250 0.23
251 0.2
252 0.17
253 0.17
254 0.14
255 0.14
256 0.14
257 0.13
258 0.12
259 0.12
260 0.13
261 0.12
262 0.13
263 0.14
264 0.13
265 0.17
266 0.16
267 0.17
268 0.15
269 0.16
270 0.15
271 0.13
272 0.13
273 0.11
274 0.13
275 0.12
276 0.12
277 0.1
278 0.11
279 0.11
280 0.11
281 0.11
282 0.12
283 0.12
284 0.11
285 0.12
286 0.14
287 0.16
288 0.18
289 0.16
290 0.15
291 0.16
292 0.17
293 0.17
294 0.18
295 0.21
296 0.24
297 0.29
298 0.32
299 0.37
300 0.45
301 0.46
302 0.46
303 0.46
304 0.45
305 0.45
306 0.43
307 0.38
308 0.29
309 0.28
310 0.27
311 0.27
312 0.24
313 0.21
314 0.25
315 0.26
316 0.29
317 0.31
318 0.32
319 0.35
320 0.43
321 0.52
322 0.51
323 0.54
324 0.56
325 0.57
326 0.53
327 0.47
328 0.4
329 0.31
330 0.28
331 0.24
332 0.21
333 0.16
334 0.16
335 0.14
336 0.13
337 0.12
338 0.12
339 0.17
340 0.18
341 0.21
342 0.23
343 0.26
344 0.27
345 0.31
346 0.32
347 0.35
348 0.32
349 0.3
350 0.33
351 0.32
352 0.34