Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U884

Protein Details
Accession A0A316U884    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
181-202EDDEKPNKKKRKTSSKEGSGDVBasic
NLS Segment(s)
PositionSequence
187-192NKKKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022649  Pr_cel_nuc_antig_C  
IPR022659  Pr_cel_nuc_antig_CS  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006260  P:DNA replication  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF02747  PCNA_C  
PF00705  PCNA_N  
PROSITE View protein in PROSITE  
PS00293  PCNA_2  
CDD cd00577  PCNA  
Amino Acid Sequences AVRELVQEANFDCSEDGIRLQAMDNSHVALSSVELRTDAFEMFRCDRPMSIGVKLDSLQKIVRTAGNEDVVTLKKDDDGDNLNLVFEATKSDRVAEYDMKLLDIDSEHLGIPDTTYEAVVRMSSAEYSRICRDLGTLGESVRIEVSKEGVNFSAEGEIGAAKLTLKQGSGSATTIDDDDDEDDEKPNKKKRKTSSKEGSGDVVPVSIELQQAVNLTFSHKYLANFAKAAPLSDAVALHMSNEVPLLVEFAFENGHVRFYLAPKLSDVSADT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.11
5 0.11
6 0.11
7 0.11
8 0.13
9 0.13
10 0.15
11 0.15
12 0.15
13 0.14
14 0.14
15 0.13
16 0.11
17 0.11
18 0.13
19 0.13
20 0.12
21 0.12
22 0.13
23 0.14
24 0.15
25 0.14
26 0.1
27 0.11
28 0.17
29 0.21
30 0.25
31 0.26
32 0.26
33 0.25
34 0.28
35 0.31
36 0.28
37 0.28
38 0.28
39 0.26
40 0.27
41 0.27
42 0.29
43 0.25
44 0.24
45 0.22
46 0.19
47 0.2
48 0.2
49 0.22
50 0.18
51 0.2
52 0.22
53 0.23
54 0.21
55 0.2
56 0.21
57 0.2
58 0.19
59 0.17
60 0.13
61 0.12
62 0.14
63 0.14
64 0.14
65 0.18
66 0.18
67 0.19
68 0.19
69 0.17
70 0.15
71 0.15
72 0.12
73 0.07
74 0.09
75 0.09
76 0.11
77 0.12
78 0.13
79 0.13
80 0.15
81 0.18
82 0.17
83 0.16
84 0.17
85 0.17
86 0.16
87 0.15
88 0.14
89 0.11
90 0.09
91 0.09
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.05
110 0.05
111 0.06
112 0.08
113 0.08
114 0.11
115 0.13
116 0.13
117 0.13
118 0.12
119 0.13
120 0.12
121 0.12
122 0.11
123 0.1
124 0.09
125 0.11
126 0.11
127 0.1
128 0.09
129 0.08
130 0.06
131 0.06
132 0.08
133 0.08
134 0.08
135 0.09
136 0.09
137 0.1
138 0.09
139 0.09
140 0.08
141 0.06
142 0.06
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.03
149 0.05
150 0.06
151 0.06
152 0.06
153 0.07
154 0.08
155 0.09
156 0.11
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.09
163 0.07
164 0.06
165 0.07
166 0.07
167 0.07
168 0.08
169 0.1
170 0.13
171 0.18
172 0.24
173 0.32
174 0.4
175 0.46
176 0.55
177 0.63
178 0.72
179 0.75
180 0.8
181 0.82
182 0.84
183 0.8
184 0.73
185 0.65
186 0.54
187 0.47
188 0.36
189 0.25
190 0.15
191 0.1
192 0.09
193 0.07
194 0.07
195 0.06
196 0.07
197 0.07
198 0.08
199 0.08
200 0.09
201 0.08
202 0.1
203 0.11
204 0.11
205 0.13
206 0.14
207 0.15
208 0.21
209 0.25
210 0.26
211 0.25
212 0.25
213 0.3
214 0.27
215 0.28
216 0.22
217 0.19
218 0.17
219 0.17
220 0.17
221 0.11
222 0.13
223 0.11
224 0.1
225 0.1
226 0.09
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.08
233 0.07
234 0.07
235 0.07
236 0.08
237 0.08
238 0.08
239 0.11
240 0.09
241 0.11
242 0.11
243 0.12
244 0.14
245 0.16
246 0.24
247 0.24
248 0.25
249 0.25
250 0.28
251 0.27