Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UBS1

Protein Details
Accession A0A316UBS1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-53LDEPPPHRRPNRPSDHTKRRAVSBasic
NLS Segment(s)
PositionSequence
94-108RREKKEAIAASRRKH
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Pfam View protein in Pfam  
PF08589  ATG43  
Amino Acid Sequences MAFFYRRASSPVPPLSPTSSSPSSAASSSSLDEPPPHRRPNRPSDHTKRRAVSPAPGAPSIGVAPAVIPDMRFEQSYLASIRGFIHELEPAQARREKKEAIAASRRKHRGVIEEEGGVGEEEEVGEEEGERWIEARNPKGEPELWIGRLRIDWVPLLYVTFRDQLLSPLVQGAVWGVVGLCLTQGKGALKAYLSAPRAQKRRGSARGGGWWGFQGVTGLQERRSRSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.44
4 0.41
5 0.39
6 0.35
7 0.33
8 0.32
9 0.31
10 0.28
11 0.25
12 0.24
13 0.18
14 0.17
15 0.17
16 0.19
17 0.17
18 0.16
19 0.19
20 0.23
21 0.31
22 0.37
23 0.44
24 0.48
25 0.56
26 0.64
27 0.71
28 0.77
29 0.75
30 0.79
31 0.81
32 0.86
33 0.85
34 0.85
35 0.77
36 0.71
37 0.71
38 0.63
39 0.59
40 0.56
41 0.52
42 0.48
43 0.44
44 0.39
45 0.31
46 0.29
47 0.22
48 0.15
49 0.09
50 0.06
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.06
57 0.09
58 0.1
59 0.1
60 0.1
61 0.1
62 0.11
63 0.13
64 0.13
65 0.12
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.1
72 0.1
73 0.09
74 0.1
75 0.11
76 0.13
77 0.12
78 0.14
79 0.18
80 0.19
81 0.21
82 0.24
83 0.23
84 0.22
85 0.29
86 0.29
87 0.31
88 0.4
89 0.43
90 0.44
91 0.52
92 0.54
93 0.47
94 0.47
95 0.42
96 0.39
97 0.38
98 0.37
99 0.3
100 0.27
101 0.26
102 0.23
103 0.22
104 0.15
105 0.09
106 0.05
107 0.03
108 0.02
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.09
121 0.12
122 0.16
123 0.19
124 0.19
125 0.21
126 0.23
127 0.23
128 0.22
129 0.25
130 0.24
131 0.23
132 0.25
133 0.24
134 0.22
135 0.22
136 0.21
137 0.16
138 0.14
139 0.12
140 0.1
141 0.11
142 0.1
143 0.11
144 0.09
145 0.09
146 0.1
147 0.11
148 0.11
149 0.11
150 0.11
151 0.12
152 0.15
153 0.14
154 0.12
155 0.11
156 0.11
157 0.1
158 0.09
159 0.08
160 0.05
161 0.05
162 0.04
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.07
172 0.08
173 0.11
174 0.12
175 0.13
176 0.13
177 0.15
178 0.17
179 0.21
180 0.22
181 0.25
182 0.32
183 0.4
184 0.46
185 0.49
186 0.53
187 0.55
188 0.63
189 0.65
190 0.65
191 0.63
192 0.62
193 0.66
194 0.65
195 0.57
196 0.48
197 0.41
198 0.35
199 0.28
200 0.22
201 0.15
202 0.1
203 0.13
204 0.17
205 0.17
206 0.22
207 0.27