Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U6Y9

Protein Details
Accession A0A316U6Y9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89KVMMAEEKKKREKAQRVKQGBasic
NLS Segment(s)
PositionSequence
77-87KKKREKAQRVK
Subcellular Location(s) plas 20, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MALSDRIVGGGMLFVAAFVFSYYTLWAFLTPFLATDSSLHSFFPSRVWAVRLPALVLVLGLGLVGAFVGKVMMAEEKKKREKAQRVKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.07
15 0.07
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.11
24 0.12
25 0.12
26 0.12
27 0.11
28 0.12
29 0.11
30 0.12
31 0.1
32 0.09
33 0.1
34 0.12
35 0.13
36 0.14
37 0.16
38 0.15
39 0.14
40 0.13
41 0.12
42 0.1
43 0.08
44 0.06
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.01
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.08
60 0.1
61 0.18
62 0.25
63 0.34
64 0.42
65 0.49
66 0.57
67 0.63
68 0.72
69 0.77