Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U735

Protein Details
Accession A0A316U735    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-71LKYHEPPEAKKPKRKWRMYVFKDGKBasic
NLS Segment(s)
PositionSequence
55-61AKKPKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000253  FHA_dom  
IPR008984  SMAD_FHA_dom_sf  
Pfam View protein in Pfam  
PF00498  FHA  
PROSITE View protein in PROSITE  
PS50006  FHA_DOMAIN  
Amino Acid Sequences MLPPAPLPLPGGERWMSSLLVLVLDQPDFKPSGLLAKESNQVNGTALKYHEPPEAKKPKRKWRMYVFKDGKEVDLLHLSRQSCYLFGRDQAVVDVPLEHTSCSKQHAVLQYRLLIERNEFGDEKRNIKPYLLDLASANGTTVNKRDVPASRYYELKNGDTIQFGGSEREYVLLCED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.16
5 0.17
6 0.12
7 0.12
8 0.11
9 0.09
10 0.09
11 0.09
12 0.1
13 0.08
14 0.1
15 0.11
16 0.11
17 0.11
18 0.09
19 0.17
20 0.17
21 0.19
22 0.19
23 0.21
24 0.27
25 0.27
26 0.29
27 0.22
28 0.21
29 0.2
30 0.21
31 0.18
32 0.15
33 0.15
34 0.16
35 0.16
36 0.18
37 0.22
38 0.22
39 0.24
40 0.33
41 0.43
42 0.48
43 0.56
44 0.63
45 0.7
46 0.78
47 0.82
48 0.81
49 0.81
50 0.85
51 0.82
52 0.84
53 0.79
54 0.72
55 0.68
56 0.59
57 0.49
58 0.39
59 0.33
60 0.23
61 0.22
62 0.19
63 0.15
64 0.18
65 0.17
66 0.16
67 0.17
68 0.16
69 0.11
70 0.12
71 0.14
72 0.11
73 0.11
74 0.14
75 0.12
76 0.12
77 0.12
78 0.11
79 0.09
80 0.08
81 0.08
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.12
90 0.12
91 0.12
92 0.16
93 0.24
94 0.28
95 0.3
96 0.31
97 0.3
98 0.3
99 0.31
100 0.28
101 0.2
102 0.17
103 0.16
104 0.15
105 0.15
106 0.15
107 0.15
108 0.22
109 0.25
110 0.28
111 0.3
112 0.34
113 0.32
114 0.32
115 0.33
116 0.27
117 0.32
118 0.28
119 0.25
120 0.2
121 0.21
122 0.21
123 0.19
124 0.16
125 0.1
126 0.1
127 0.11
128 0.12
129 0.14
130 0.15
131 0.16
132 0.21
133 0.24
134 0.28
135 0.34
136 0.39
137 0.37
138 0.4
139 0.41
140 0.43
141 0.42
142 0.39
143 0.35
144 0.32
145 0.31
146 0.28
147 0.27
148 0.21
149 0.19
150 0.18
151 0.17
152 0.15
153 0.15
154 0.13
155 0.14
156 0.14