Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U1H2

Protein Details
Accession A0A316U1H2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MRLRPRKREKRFGWHSGICPRRRNKNTDSHPRKARPBasic
NLS Segment(s)
PositionSequence
4-33RPRKREKRFGWHSGICPRRRNKNTDSHPRK
Subcellular Location(s) plas 14, nucl 8, mito 3
Family & Domain DBs
Amino Acid Sequences MRLRPRKREKRFGWHSGICPRRRNKNTDSHPRKARPPVSCAQNGPKPILSNLRQGYASWVKTASPPISLFISSLHPRRPVCLVLVYIYLISILPEHFQTSTHPQSGSDLLLLLRVETHAFNHLLIHDAVSCEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.76
4 0.76
5 0.71
6 0.71
7 0.7
8 0.71
9 0.72
10 0.73
11 0.7
12 0.72
13 0.75
14 0.78
15 0.79
16 0.77
17 0.8
18 0.78
19 0.79
20 0.77
21 0.75
22 0.68
23 0.66
24 0.63
25 0.6
26 0.59
27 0.55
28 0.52
29 0.49
30 0.46
31 0.42
32 0.37
33 0.31
34 0.29
35 0.33
36 0.28
37 0.31
38 0.31
39 0.3
40 0.28
41 0.27
42 0.31
43 0.29
44 0.27
45 0.2
46 0.19
47 0.17
48 0.18
49 0.21
50 0.15
51 0.12
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.1
58 0.14
59 0.15
60 0.17
61 0.19
62 0.22
63 0.22
64 0.24
65 0.25
66 0.22
67 0.21
68 0.2
69 0.18
70 0.15
71 0.16
72 0.14
73 0.11
74 0.1
75 0.08
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.12
86 0.19
87 0.23
88 0.25
89 0.25
90 0.24
91 0.26
92 0.28
93 0.25
94 0.17
95 0.13
96 0.11
97 0.13
98 0.12
99 0.1
100 0.08
101 0.08
102 0.09
103 0.09
104 0.11
105 0.12
106 0.13
107 0.13
108 0.14
109 0.14
110 0.16
111 0.15
112 0.15
113 0.12