Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U921

Protein Details
Accession A0A316U921    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-76LSALACIKCRRRLKKKGYAKARCHydrophilic
NLS Segment(s)
PositionSequence
64-70RRLKKKG
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTSKGKDVAMRIRERVQKEQECEEEEEGEEETSSRGRRQAEERDEARGRLRLPLSALACIKCRRRLKKKGYAKARC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.6
4 0.59
5 0.58
6 0.6
7 0.56
8 0.52
9 0.5
10 0.42
11 0.34
12 0.27
13 0.23
14 0.18
15 0.14
16 0.1
17 0.07
18 0.07
19 0.08
20 0.08
21 0.09
22 0.11
23 0.12
24 0.15
25 0.21
26 0.29
27 0.33
28 0.39
29 0.39
30 0.43
31 0.43
32 0.41
33 0.38
34 0.32
35 0.27
36 0.26
37 0.26
38 0.2
39 0.21
40 0.26
41 0.24
42 0.25
43 0.27
44 0.23
45 0.27
46 0.32
47 0.36
48 0.4
49 0.48
50 0.55
51 0.64
52 0.73
53 0.79
54 0.84
55 0.9
56 0.91