Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U8C0

Protein Details
Accession A0A316U8C0   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRIRHKRTHHARRDVSRAARBasic
75-100DREVHWKSKLHKRKAKKVREELPYTQBasic
NLS Segment(s)
PositionSequence
81-92KSKLHKRKAKKV
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRIRHKRTHHARRDVSRAARTRARNLDFDQVHANLHDASKRSELENPTELDVDKPGLGVYYCIECDRHFPRAEDREVHWKSKLHKRKAKKVREELPYTQEEADRGAGVGVDRGER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.8
4 0.77
5 0.73
6 0.68
7 0.67
8 0.63
9 0.63
10 0.64
11 0.6
12 0.55
13 0.53
14 0.56
15 0.48
16 0.46
17 0.41
18 0.32
19 0.29
20 0.24
21 0.22
22 0.13
23 0.14
24 0.14
25 0.12
26 0.14
27 0.16
28 0.17
29 0.17
30 0.21
31 0.23
32 0.25
33 0.26
34 0.25
35 0.23
36 0.23
37 0.21
38 0.17
39 0.15
40 0.11
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.13
54 0.15
55 0.2
56 0.2
57 0.21
58 0.29
59 0.34
60 0.37
61 0.35
62 0.35
63 0.41
64 0.42
65 0.43
66 0.39
67 0.37
68 0.41
69 0.49
70 0.56
71 0.56
72 0.62
73 0.7
74 0.77
75 0.84
76 0.88
77 0.88
78 0.88
79 0.86
80 0.87
81 0.84
82 0.79
83 0.74
84 0.66
85 0.58
86 0.49
87 0.41
88 0.32
89 0.27
90 0.22
91 0.16
92 0.14
93 0.11
94 0.1
95 0.09
96 0.11