Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U708

Protein Details
Accession A0A316U708   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
193-212REERRKRKEEGDHRSRHRDHBasic
280-305QDDDEERSRRRNSRDREHSAPQRDRABasic
NLS Segment(s)
PositionSequence
64-74RREELREIKRR
175-236KLAKMEWKRLRHEERERIREERRKRKEEGDHRSRHRDHGGDRDRRPETREGQDRYERRRDRS
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MYHPTRGGTRGGQAEFSWQDVRNDKDRENYLGHSVNAPTGRWQKGKDVNWYNKDKGEGDEGEKRREELREIKRREEEEIRRRLGGAPLPPSLSSSSLEGPRLGANLLSGSASRSSHHDPSTSTGSNRSHLDPSKARKWGRGEGSTAGAVPGEARSNSPDDAAPGVTEEEKRIAMKLAKMEWKRLRHEERERIREERRKRKEEGDHRSRHRDHGGDRDRRPETREGQDRYERRRDRSDSRDGSRDHRRDRSYSPDYHRRARYSRHDSPGYRNEDRHRRTDQDDDEERSRRRNSRDREHSAPQRDRADRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.33
4 0.31
5 0.26
6 0.3
7 0.34
8 0.39
9 0.4
10 0.44
11 0.42
12 0.46
13 0.48
14 0.48
15 0.46
16 0.43
17 0.41
18 0.4
19 0.38
20 0.33
21 0.3
22 0.3
23 0.27
24 0.25
25 0.27
26 0.3
27 0.36
28 0.37
29 0.38
30 0.43
31 0.51
32 0.56
33 0.59
34 0.62
35 0.66
36 0.7
37 0.75
38 0.69
39 0.63
40 0.6
41 0.51
42 0.43
43 0.4
44 0.34
45 0.32
46 0.38
47 0.38
48 0.4
49 0.39
50 0.38
51 0.35
52 0.35
53 0.35
54 0.35
55 0.43
56 0.49
57 0.53
58 0.58
59 0.62
60 0.61
61 0.62
62 0.62
63 0.61
64 0.61
65 0.65
66 0.6
67 0.54
68 0.53
69 0.49
70 0.43
71 0.38
72 0.33
73 0.28
74 0.27
75 0.28
76 0.27
77 0.26
78 0.24
79 0.2
80 0.16
81 0.15
82 0.16
83 0.17
84 0.18
85 0.16
86 0.16
87 0.15
88 0.14
89 0.12
90 0.09
91 0.07
92 0.06
93 0.07
94 0.06
95 0.05
96 0.06
97 0.07
98 0.08
99 0.08
100 0.13
101 0.17
102 0.21
103 0.22
104 0.22
105 0.22
106 0.26
107 0.31
108 0.28
109 0.24
110 0.26
111 0.26
112 0.27
113 0.28
114 0.26
115 0.25
116 0.25
117 0.31
118 0.31
119 0.37
120 0.41
121 0.46
122 0.44
123 0.45
124 0.49
125 0.5
126 0.49
127 0.45
128 0.4
129 0.35
130 0.36
131 0.3
132 0.25
133 0.18
134 0.11
135 0.09
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.07
142 0.08
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.08
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.1
160 0.11
161 0.13
162 0.15
163 0.18
164 0.26
165 0.27
166 0.35
167 0.4
168 0.44
169 0.47
170 0.53
171 0.56
172 0.58
173 0.66
174 0.68
175 0.7
176 0.72
177 0.71
178 0.67
179 0.69
180 0.68
181 0.69
182 0.7
183 0.71
184 0.69
185 0.69
186 0.73
187 0.75
188 0.77
189 0.77
190 0.76
191 0.76
192 0.76
193 0.81
194 0.74
195 0.69
196 0.64
197 0.58
198 0.51
199 0.53
200 0.57
201 0.56
202 0.57
203 0.6
204 0.58
205 0.55
206 0.56
207 0.51
208 0.48
209 0.48
210 0.55
211 0.5
212 0.54
213 0.61
214 0.64
215 0.64
216 0.69
217 0.65
218 0.61
219 0.66
220 0.66
221 0.66
222 0.67
223 0.7
224 0.67
225 0.67
226 0.69
227 0.62
228 0.63
229 0.64
230 0.65
231 0.62
232 0.63
233 0.62
234 0.6
235 0.63
236 0.65
237 0.61
238 0.61
239 0.63
240 0.64
241 0.66
242 0.7
243 0.72
244 0.69
245 0.68
246 0.69
247 0.71
248 0.7
249 0.73
250 0.73
251 0.74
252 0.71
253 0.74
254 0.74
255 0.71
256 0.66
257 0.63
258 0.64
259 0.67
260 0.68
261 0.66
262 0.64
263 0.61
264 0.61
265 0.65
266 0.62
267 0.61
268 0.62
269 0.62
270 0.62
271 0.63
272 0.6
273 0.58
274 0.59
275 0.58
276 0.61
277 0.64
278 0.68
279 0.72
280 0.8
281 0.81
282 0.81
283 0.84
284 0.84
285 0.85
286 0.83
287 0.79
288 0.78