Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U9W8

Protein Details
Accession A0A316U9W8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-93ELIRNSKDKRARKFMKRRLGTLRRBasic
NLS Segment(s)
PositionSequence
36-40RPSRR
74-94NSKDKRARKFMKRRLGTLRRA
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MGNSSNPAHKAGVPRTGLVWGINRGHKTERRVLPQRPSRRKGAQTQRTQIVKSVVREVAGFAPYERRAMELIRNSKDKRARKFMKRRLGTLRRAKFTMERLTNTIAEQRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.3
5 0.24
6 0.23
7 0.2
8 0.23
9 0.27
10 0.27
11 0.28
12 0.34
13 0.38
14 0.4
15 0.45
16 0.47
17 0.52
18 0.59
19 0.63
20 0.66
21 0.71
22 0.76
23 0.77
24 0.74
25 0.73
26 0.72
27 0.72
28 0.72
29 0.73
30 0.72
31 0.7
32 0.71
33 0.71
34 0.65
35 0.6
36 0.52
37 0.46
38 0.39
39 0.32
40 0.3
41 0.23
42 0.21
43 0.21
44 0.19
45 0.15
46 0.13
47 0.11
48 0.08
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.11
55 0.12
56 0.18
57 0.21
58 0.28
59 0.31
60 0.37
61 0.37
62 0.44
63 0.51
64 0.54
65 0.55
66 0.59
67 0.65
68 0.7
69 0.8
70 0.83
71 0.85
72 0.82
73 0.8
74 0.8
75 0.8
76 0.79
77 0.78
78 0.77
79 0.71
80 0.67
81 0.64
82 0.58
83 0.56
84 0.57
85 0.52
86 0.47
87 0.46
88 0.48
89 0.46
90 0.42
91 0.43
92 0.37
93 0.34