Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U5N5

Protein Details
Accession A0A316U5N5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVKSQTPKVEKQEKKKTPKGRAKKRILYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKKKTPKGRAKKRI
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRILYNRRFVNVQLGPGGKRKMNSNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.61
7 0.65
8 0.71
9 0.71
10 0.74
11 0.77
12 0.78
13 0.81
14 0.8
15 0.81
16 0.81
17 0.84
18 0.85
19 0.85
20 0.86
21 0.87
22 0.87
23 0.87
24 0.88
25 0.88
26 0.85
27 0.83
28 0.8
29 0.73
30 0.65
31 0.56
32 0.54
33 0.46
34 0.39
35 0.35
36 0.29
37 0.28
38 0.33
39 0.36
40 0.29
41 0.29