Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U3A0

Protein Details
Accession A0A316U3A0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-57GQEYQPSQRKRKRKHGFLARIKTKNGRKMLARRRLQGRRFBasic
NLS Segment(s)
PositionSequence
26-56RKRKRKHGFLARIKTKNGRKMLARRRLQGRR
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences LPSSQLFQLGGVRCATYGQEYQPSQRKRKRKHGFLARIKTKNGRKMLARRRLQGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.13
5 0.13
6 0.19
7 0.2
8 0.26
9 0.34
10 0.4
11 0.47
12 0.53
13 0.61
14 0.63
15 0.74
16 0.78
17 0.79
18 0.82
19 0.84
20 0.87
21 0.87
22 0.89
23 0.87
24 0.8
25 0.74
26 0.72
27 0.69
28 0.66
29 0.62
30 0.56
31 0.56
32 0.62
33 0.7
34 0.72
35 0.71
36 0.71
37 0.76
38 0.81
39 0.79
40 0.78